FGF-18 Protein, Mouse (HEK293, His)
The FGF-18 protein plays a key role in regulating cell proliferation, differentiation, and migration, particularly in normal ossification and bone development, showing its critical role in skeletal maturation. In addition, FGF-18 stimulates liver and intestinal proliferation, highlighting its multifunctional role in various tissues. FGF-18 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-18 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FGF-18 protein plays a key role in regulating cell proliferation, differentiation, and migration, particularly in normal ossification and bone development, showing its critical role in skeletal maturation. In addition, FGF-18 stimulates liver and intestinal proliferation, highlighting its multifunctional role in various tissues. FGF-18 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-18 protein, expressed by HEK293 , with C-His labeled tag.
Background
FGF-18 protein assumes a pivotal role in orchestrating the intricate regulation of cell proliferation, differentiation, and migration. Its indispensable functions extend to the realm of normal ossification and bone development, highlighting its critical involvement in skeletal maturation. Furthermore, FGF-18 exhibits the capacity to stimulate hepatic and intestinal proliferation, underscoring its versatile role in various tissues. The orchestration of these cellular processes is facilitated through interactions with FGFR3 and FGFR4, underscoring the significance of FGF-18 in mediating intricate signaling pathways that contribute to the fundamental processes of tissue development and homeostasis.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
O89101 (E28-G207)
-
Molecular Construction
-
N-term
-
FGF-18 (E28-G207)
Accession # O89101 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF18; ZFGF5; Fibroblast Growth Factor 18; Fibroblast Growth Factor; FGF-18; FGF
-
AA Sequence
EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG
-
Predicted Molecular Mass
22.5 kDa
-
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
