1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-18
  6. FGF-18 Protein, Mouse (HEK293, His)

The FGF-18 protein plays a key role in regulating cell proliferation, differentiation, and migration, particularly in normal ossification and bone development, showing its critical role in skeletal maturation. In addition, FGF-18 stimulates liver and intestinal proliferation, highlighting its multifunctional role in various tissues. FGF-18 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-18 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGF-18 protein plays a key role in regulating cell proliferation, differentiation, and migration, particularly in normal ossification and bone development, showing its critical role in skeletal maturation. In addition, FGF-18 stimulates liver and intestinal proliferation, highlighting its multifunctional role in various tissues. FGF-18 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-18 protein, expressed by HEK293 , with C-His labeled tag.

Background

FGF-18 protein assumes a pivotal role in orchestrating the intricate regulation of cell proliferation, differentiation, and migration. Its indispensable functions extend to the realm of normal ossification and bone development, highlighting its critical involvement in skeletal maturation. Furthermore, FGF-18 exhibits the capacity to stimulate hepatic and intestinal proliferation, underscoring its versatile role in various tissues. The orchestration of these cellular processes is facilitated through interactions with FGFR3 and FGFR4, underscoring the significance of FGF-18 in mediating intricate signaling pathways that contribute to the fundamental processes of tissue development and homeostasis.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

O89101 (E28-G207)

Gene ID
Molecular Construction
N-term
FGF-18 (E28-G207)
Accession # O89101
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Fibroblast growth factor 18; FGF-18; zFGF5; Fgf18
AA Sequence

EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG

Predicted Molecular Mass
22.5 kDa
Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGF-18 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGF-18 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-18 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75192
Quantity:
MCE Japan Authorized Agent: