FGF-20 Protein, Mouse (His)
FGF-20 Protein, Mouse (His) is the recombinant mouse-derived FGF-20 protein, expressed by E. coli, with N-6*His tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
FGF-20 Protein, Mouse (His) is the recombinant mouse-derived FGF-20 protein, expressed by E. coli, with N-6*His tag.
FGF-20 protein serves as a neurotrophic factor crucial for the regulation of central nervous system development and function. Operating as a homodimer, it interacts with specific receptors, namely FGFR2 and FGFR4. The binding affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by heparan sulfate glycosaminoglycans, acting as coreceptors in this intricate signaling process.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9ESL9 (M1-T211)
-
Gene ID80857
-
Molecular Construction
-
N-term
-
6*His
-
FGF-20 (M1-T221)
Accession # Q9ESL9 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FGF20; FGF20 Protein; Fibroblast Growth Factor 20; RHDA2; FGF-20; FGF; Fibroblast Growth Factor
-
AA Sequence
MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
-
Predicted Molecular Mass
27.7 kDa
-
Molecular Weight
Approximately 27.7 kDa,based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
