1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. Fibroblast Growth Factor 21 (FGF-21)
  6. FGF-21 Protein, Human (HEK293, mFc-Avi)

FGF-21 Proteinas, pivotal in promoting glucose uptake in adipocytes, induces SLC2A1/GLUT1 expression, not affecting SLC2A4/GLUT4, contingent on KLB.It significantly regulates systemic glucose homeostasis and insulin sensitivity, with direct KLB interaction via its C-terminus.Engagement with FGFR4 adds complexity to its molecular mechanisms, highlighting its role in orchestrating cellular responses beyond localized effects.FGF-21 Protein, Human (HEK293, mFc-Avi) is the recombinant human-derived FGF-21 protein, expressed by HEK293 , with N-mFc, N-Avi labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

FGF-21 Proteinas, pivotal in promoting glucose uptake in adipocytes, induces SLC2A1/GLUT1 expression, not affecting SLC2A4/GLUT4, contingent on KLB.It significantly regulates systemic glucose homeostasis and insulin sensitivity, with direct KLB interaction via its C-terminus.Engagement with FGFR4 adds complexity to its molecular mechanisms, highlighting its role in orchestrating cellular responses beyond localized effects.FGF-21 Protein, Human (HEK293, mFc-Avi) is the recombinant human-derived FGF-21 protein, expressed by HEK293 , with N-mFc, N-Avi labeled tag.

Background

The FGF-21 protein plays a pivotal role in promoting glucose uptake within differentiated adipocytes by specifically inducing the expression of the glucose transporter SLC2A1/GLUT1, while not affecting SLC2A4/GLUT4 expression. Its activity is contingent upon the presence of KLB. Beyond its localized effects, this protein contributes significantly to the regulation of systemic glucose homeostasis and insulin sensitivity. The direct interaction with KLB, facilitated via its C-terminus, underscores the molecular basis of its functionality. Additionally, the protein engages with FGFR4, further highlighting the complexity of its interactions in orchestrating cellular responses.

Biological Activity

Immobilized Human FGF21 at 5 μg/mL (100 μl/Well) on the plate. Dose response curve for Human Beta Klotho, His Tag with the EC50 of 2.29 μg/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

N-mFc;N-Avi

Accession

Q9NSA1 (H29-S209)

Gene ID
Molecular Construction
N-term
mFc-Avi
FGF-21 (H29-S209)
Accession # Q9NSA1
C-term
Protein Length

Full Length of Mature Protein

Synonyms
UNQ3115; PRO10196; FGF-21; FGF21
AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Predicted Molecular Mass
46.9 kDa
분자량

Approximately 52-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

FGF-21 Protein, Human (HEK293, mFc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

FGF-21 Protein, Human (HEK293, mFc-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
FGF-21 Protein, Human (HEK293, mFc-Avi)
Cat. No.:
HY-P78442
수량:
MCE Japan Authorized Agent: