Copy Link Print Information

FGF-23 Protein, Mouse (R179Q, HEK293, His)

Customer Review

Based on 1 Customer Validation

FGF-23 protein is a key regulator that maintains phosphate homeostasis by inhibiting tubular phosphate transport and reducing SLC34A1 levels. It directly inhibits PTH secretion, regulates vitamin D metabolism, and negatively affects osteoblast differentiation and matrix mineralization. FGF-23 Protein, Mouse (R179Q, HEK293, His) is the recombinant mouse-derived FGF-23 protein, expressed by HEK293 , with C-6*His labeled tag and R179Q mutation.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-23 Protein, Mouse (R179Q, HEK293, His)
  • Experimental Validation Results for FGF-23 Protein, Mouse (R179Q, HEK293, His)
  • FGF-23 Protein, Mouse (R179Q, HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-23 protein is a key regulator that maintains phosphate homeostasis by inhibiting tubular phosphate transport and reducing SLC34A1 levels. It directly inhibits PTH secretion, regulates vitamin D metabolism, and negatively affects osteoblast differentiation and matrix mineralization. FGF-23 Protein, Mouse (R179Q, HEK293, His) is the recombinant mouse-derived FGF-23 protein, expressed by HEK293 , with C-6*His labeled tag and R179Q mutation.

Background

FGF-23 protein serves as a key regulator in maintaining phosphate homeostasis by inhibiting renal tubular phosphate transport, primarily through the reduction of SLC34A1 levels. Additionally, it acts directly on the parathyroid to suppress PTH secretion and plays a pivotal role in vitamin-D metabolism regulation. FGF-23 serves as a negative regulator of osteoblast differentiation and matrix mineralization. Furthermore, it exhibits the ability to up-regulate EGR1 expression in the presence of KL and interacts with various fibroblast growth factor receptors (FGFRs), including FGFR1, FGFR2, FGFR3, and FGFR4. The interaction between FGF-23 and FGFRs is facilitated by KL and heparan sulfate glycosaminoglycans, acting as coreceptors.

Verified Bioactivity

Determined by its ability to stimulate the proliferation of murine NIH-3T3 cells. The ED50 for this effect is 0.2-0.5 μg/mL in the presence of 1 μg/mL murine Klotho and 100 μg/mL heparin.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9EPC2 (Y25-V251, R179Q)

  • Gene ID
    64654
  • Molecular Construction
    • N-term
    • FGF-23 (Y25-V251, R179Q)
      Accession # Q9EPC2
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF23; FGF-23; Fibroblast Growth Factor 23; HFTC2; Phosphatonin; HPDR2; HYPF; PHPTC; Tumor-Derived Hypophosphatemia Inducing Factor; ADHR; Tumor-Derived Hypophosphatemia-Inducing Factor; FGFN

  • AA Sequence

    YPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTLENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTQSAEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGGADRCRPFPRFV

  • Predicted Molecular Mass

    25.3 kDa

  • Molecular Weight

    Approximately 30-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM MOPS, 150 mM NaCl, pH 7.4, 1 mM EDTA, 1 mM DTT, 8% trehalose.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Determined by its ability to stimulate the proliferation of murine NIH-3T3 cells. The ED50 for this effect is 0.2468 μg/mL in the presence of 1 μg/mL murine Klotho and 100 μg/mL heparin, corresponding to a specific activity is 4.051×103 units/mg.

  • FGF-23 Protein, Mouse (R179Q, HEK293, His) Product Image
    1/16
  • Experimental Validation Results for FGF-23 Protein, Mouse (R179Q, HEK293, His)
  • Experimental Validation Results for FGF-23 Protein, Mouse (R179Q, HEK293, His)
  • FGF-23 Protein, Mouse (R179Q, HEK293, His) Product Image