Copy Link Print Information

FGF-4 Protein, Human (166a.a, His)

Customer Review

Based on 1 Customer Validation

FGF-4 Protein, Human (166a.a) is a member of the FGF family that transforms 3T3 cells with high efficiency, stimulates endothelial cell proliferation, migration, and protease production, and shows angiogenic activity.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-4 Protein, Human (166a.a, His)
  • Experimental Validation Results for FGF-4 Protein, Human (166a.a, His)
  • FGF-4 Protein, Human (166a.a, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-4 Protein, Human (166a.a) is a member of the FGF family that transforms 3T3 cells with high efficiency, stimulates endothelial cell proliferation, migration, and protease production, and shows angiogenic activity.

Background

Fibroblast Growth Factor 4 (EGF 4) is a member of the FGF family that transforms 3T3 cells with high efficiency, stimulates endothelial cell proliferation, migration, and protease production, and shows angiogenic activity[1].

Verified Bioactivity

Measured in a cell proliferation assay using NIH-3T3 cells. The ED50 for this effect is 0.996 ng/mL, corresponding to a specific activity is 1.0×10^6 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using NIH-3T3 cells. The ED50 for this effect is 0.996 ng/mL, corresponding to a specific activity is 1.0×106 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P08620-1 (A41-L206)

  • Gene ID
    2249
  • Molecular Construction
    • N-term
    • 6*His
    • FGF-4 (A41-L206)
      Accession # P08620-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FGF4; Heparin-Binding Growth Factor 4; Prev. HSTF1; HSTF-1; HBGF-4; FGF-4; HST-1; Heparin Secretory-Transforming Protein 1; HST; Fibroblast Growth Factor; Transforming Protein KS3; Oncogene HST; K-FGF; SRTD22; KFGF; KS3; Human Stomach Cancer, Transforming

  • AA Sequence

    AELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

  • Predicted Molecular Mass

    19.2 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 750 mM NaCl, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using NIH-3T3 cells. The ED50 for this effect is 0.996 ng/mL, corresponding to a specific activity is 1.0×106 units/mg.

  • FGF-4 Protein, Human (166a.a, His) Product Image
    1/16
  • Experimental Validation Results for FGF-4 Protein, Human (166a.a, His)
  • Experimental Validation Results for FGF-4 Protein, Human (166a.a, His)
  • FGF-4 Protein, Human (166a.a, His) Product Image