FGF-8b Protein, Human/Mouse (HEK293, His)
FGF-8b Protein, Human/Mouse (HEK293, His) is the recombinant human-derived FGF-8b protein, expressed by HEK293, with C-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FGF-8b Protein, Human/Mouse (HEK293, His) is the recombinant human-derived FGF-8b protein, expressed by HEK293, with C-His tag.
Background
FGF-8b plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation, and cell migration. It is required for normal brain, eye, ear, and limb development during embryogenesis. Additionally, FGF-8b is essential for the normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (by similar: PubMed:16384934, PubMed:16597617, PubMed:8663044). It also functions in neurite outgrowth in hippocampal cells (by similar: PubMed:21576111).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P55075-3/P37237-2 (Q23-R215)
-
Gene ID2253/14179
-
Molecular Construction
-
N-term
-
FGF-8b (Q23-R215)
Accession # P55075-3/P37237-2 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
FGF8; HBGF-8; Fibroblast Growth Factor 8; FGF-8; AIGF; Fibroblast Growth Factor; Androgen-Induced Growth Factor; KAL6; Fibroblast Growth Factor 8 (Androgen-Induced); HH6; Heparin-Binding Growth Factor 8; FGF
-
AA Sequence
QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
-
Predicted Molecular Mass
24.3 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
