FGF-8e Protein, Human (193a.a)

FGF-8e Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

Fibroblast Growth Factor 8 is an essential factor during embryonic development, overexpressed in several tumor types. Fibroblast Growth Factor 8 stimulates anti-apoptotic pathways and prevents tumor cell death^[1].

Measured in a cell proliferation assay using BALB/c 3T3 mouse fibroblasts. The ED₅₀ for this effect is 166.1 ng/mL, corresponding to a specific activity is 6020.4696 units/mg.

• 
  Measured in a cell proliferation assay using BALB/c 3T3 mouse fibroblasts. The ED₅₀ for this effect is 166.1 ng/mL, corresponding to a specific activity is 6020.4696 units/mg.

Human

E. coli

Tag Free

P55075-1 (Q23-P215)

2253

Partial

QEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYP

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.