1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-8
  6. FGF-8e Protein, Human (N-His)

FGF-8e Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-8e Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

Background

Fibroblast Growth Factor 8 is an essential factor during embryonic development, overexpressed in several tumor types. Fibroblast Growth Factor 8 stimulates anti-apoptotic pathways and prevents tumor cell death[1].

Biological Activity

Measured in a cell proliferation assay using Balb/3T3 mouse fibroblast cells. The ED50 for this effect is 1.064 μg/mL, corresponding to a specific activity is 939.85 units/mg.

  • Measured in a cell proliferation assay using Balb/3T3 mouse fibroblast cells. The ED50 for this effect is 1.064 μg/mL, corresponding to a specific activity is 939.85 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P55075-1 (Q23-R233)

Gene ID
Molecular Construction
N-term
6*His
FGF-8e (Q23-R233)
Accession # P55075-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Fibroblast growth factor 8; Androgen-induced growth factor; Heparin-binding growth factor 8; AIGF; HBGF-8; FGF-8B
AA Sequence

QEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Predicted Molecular Mass
24.2 kDa
Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-8e Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGF-8e Protein, Human (N-His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-8e Protein, Human (N-His)
Cat. No.:
HY-P7349A
Quantity:
MCE Japan Authorized Agent: