FGF-9 Protein, Human (HEK293, His)
The FGF-9 protein plays a key role in embryonic development, controlling cell proliferation, differentiation, and migration. Its diverse functions include glial cell growth and differentiation, gliosis in brain repair, neuronal cell differentiation and survival, and promotion of glioma growth. FGF-9, Human (HEK293, His) is the recombinant human-derived FGF-9 protein, expressed by HEK293, with N-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FGF-9 protein plays a key role in embryonic development, controlling cell proliferation, differentiation, and migration. Its diverse functions include glial cell growth and differentiation, gliosis in brain repair, neuronal cell differentiation and survival, and promotion of glioma growth. FGF-9, Human (HEK293, His) is the recombinant human-derived FGF-9 protein, expressed by HEK293, with N-6*His labeled tag.
Background
FGF-9 Protein assumes a pivotal role in governing embryonic development, cell proliferation, differentiation, and migration. Its involvement extends to diverse processes, including glial cell growth and differentiation during development, gliosis in the brain's repair and regeneration after injury, differentiation and survival of neuronal cells, and the promotion of growth in glial tumors. Operating as a monomer or homodimer, FGF-9 engages in intricate interactions with FGFR1, FGFR2, FGFR3, and FGFR4, forming molecular alliances critical for diverse cellular responses. The binding affinity between FGF-9 and its receptors is potentiated by heparan sulfate glycosaminoglycans, acting as essential coreceptors. These interactions underscore the multifaceted and indispensable role of FGF-9 in orchestrating crucial cellular events across various physiological contexts.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
P31371 (L4-S208)
-
Gene ID2254
-
Molecular Construction
-
N-term
-
His
-
FGF-9 (L4-S208)
Accession # P31371 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF9; FGF-9; Fibroblast Growth Factor 9; GAF; Fibroblast Growth Factor 9 (Glia-Activating Factor); Fibroblast Growth Factor; Heparin-Binding Growth Factor 9; HBFG-9; Glia-Activating Factor; SYNS3; HBGF-9; FGF
-
AA Sequence
LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
-
Predicted Molecular Mass
25 kDa
-
Molecular Weight
Approximately 29-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
