FGFBP3 Protein, Human (sf9, His)
The FGFBP3 protein is a heparin-binding protein that complexly regulates fibroblast growth factor 2 (FGF2) dynamics. By forming a binding complex with FGF2, it blocks heparin binding of FGF2 and may limit its anchoring to extracellular matrix glycosaminoglycans. FGFBP3 Protein, Human (sf9, His) is the recombinant human-derived FGFBP3 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FGFBP3 protein is a heparin-binding protein that complexly regulates fibroblast growth factor 2 (FGF2) dynamics. By forming a binding complex with FGF2, it blocks heparin binding of FGF2 and may limit its anchoring to extracellular matrix glycosaminoglycans. FGFBP3 Protein, Human (sf9, His) is the recombinant human-derived FGFBP3 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
FGFBP3 Protein, identified as a heparin-binding protein, intricately regulates the dynamics of fibroblast growth factor 2 (FGF2). This versatile protein forms a binding complex with FGF2, simultaneously impeding its binding to heparin and likely hindering the immobilization of FGF2 on extracellular matrix glycosaminoglycans. This dual mechanism facilitates the liberation of FGF2, enabling its release and subsequent initiation of fibroblast growth factor receptor (FGFR) signaling. The downstream activation of FGFR signaling orchestrated by FGFBP3 Protein is implicated in the augmentation of vascular permeability. Importantly, the direct interaction between FGFBP3 Protein and FGF2 underscores the pivotal role of this protein in orchestrating these intricate cellular processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q8TAT2 (R27-G258)
-
Molecular Construction
-
N-term
-
FGFBP3 (R27-G258)
Accession # Q8TAT2 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGFBP3; MGC39320; Prev. C10orf13; FGFBP-3; Fibroblast Growth Factor-Binding Protein 3; Chromosome 10 Open Reading Frame 13; FGF-Binding Protein 3; Fibroblast Growth Factor Binding Protein 3; FGF-BP3
-
AA Sequence
RREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG
-
Predicted Molecular Mass
26.4 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
