1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. FGFBP3 Protein, Human (sf9, His)

The FGFBP3 protein is a heparin-binding protein that complexly regulates fibroblast growth factor 2 (FGF2) dynamics. By forming a binding complex with FGF2, it blocks heparin binding of FGF2 and may limit its anchoring to extracellular matrix glycosaminoglycans. FGFBP3 Protein, Human (sf9, His) is the recombinant human-derived FGFBP3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGFBP3 protein is a heparin-binding protein that complexly regulates fibroblast growth factor 2 (FGF2) dynamics. By forming a binding complex with FGF2, it blocks heparin binding of FGF2 and may limit its anchoring to extracellular matrix glycosaminoglycans. FGFBP3 Protein, Human (sf9, His) is the recombinant human-derived FGFBP3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

FGFBP3 Protein, identified as a heparin-binding protein, intricately regulates the dynamics of fibroblast growth factor 2 (FGF2). This versatile protein forms a binding complex with FGF2, simultaneously impeding its binding to heparin and likely hindering the immobilization of FGF2 on extracellular matrix glycosaminoglycans. This dual mechanism facilitates the liberation of FGF2, enabling its release and subsequent initiation of fibroblast growth factor receptor (FGFR) signaling. The downstream activation of FGFR signaling orchestrated by FGFBP3 Protein is implicated in the augmentation of vascular permeability. Importantly, the direct interaction between FGFBP3 Protein and FGF2 underscores the pivotal role of this protein in orchestrating these intricate cellular processes.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q8TAT2 (R27-G258)

Gene ID
Molecular Construction
N-term
FGFBP3 (R27-G258)
Accession # Q8TAT2
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Fibroblast growth factor-binding protein 3; FGF-BP3; C10orf13
AA Sequence

RREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG

Predicted Molecular Mass
26.4 kDa
Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGFBP3 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGFBP3 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGFBP3 Protein, Human (sf9, His)
Cat. No.:
HY-P76926
Quantity:
MCE Japan Authorized Agent: