FGFBP3 Protein, Human (sf9, His)

The FGFBP3 protein is a heparin-binding protein that complexly regulates fibroblast growth factor 2 (FGF2) dynamics. By forming a binding complex with FGF2, it blocks heparin binding of FGF2 and may limit its anchoring to extracellular matrix glycosaminoglycans. FGFBP3 Protein, Human (sf9, His) is the recombinant human-derived FGFBP3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

FGFBP3 Protein, identified as a heparin-binding protein, intricately regulates the dynamics of fibroblast growth factor 2 (FGF2). This versatile protein forms a binding complex with FGF2, simultaneously impeding its binding to heparin and likely hindering the immobilization of FGF2 on extracellular matrix glycosaminoglycans. This dual mechanism facilitates the liberation of FGF2, enabling its release and subsequent initiation of fibroblast growth factor receptor (FGFR) signaling. The downstream activation of FGFR signaling orchestrated by FGFBP3 Protein is implicated in the augmentation of vascular permeability. Importantly, the direct interaction between FGFBP3 Protein and FGF2 underscores the pivotal role of this protein in orchestrating these intricate cellular processes.

Human

Sf9 insect cells

C-His

Q8TAT2 (R27-G258)

143282  [NCBI]

Full Length of Mature Protein

RREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG

Approximately 33 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.