Copy Link Print Information

FGL1 Protein, Mouse (sf9, His)

Customer Review

Based on 1 Customer Validation

FGL1 Protein, a potent immune suppressive molecule, inhibits antigen-specific T-cell activation as a major ligand for LAG3. It crucially contributes to LAG3-mediated T-cell inhibitory functions, independently of MHC class II. Secreted by hepatocytes, FGL1 also promotes their growth. The homodimeric form of the protein interacts with LAG3, specifically engaging with its Ig-like domains 1 and 2 through the Fibrinogen C-terminal domain. FGL1 Protein, Mouse (sf9, His) is the recombinant mouse-derived FGL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • FGL1 Protein, Mouse (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGL1 Protein, a potent immune suppressive molecule, inhibits antigen-specific T-cell activation as a major ligand for LAG3. It crucially contributes to LAG3-mediated T-cell inhibitory functions, independently of MHC class II. Secreted by hepatocytes, FGL1 also promotes their growth. The homodimeric form of the protein interacts with LAG3, specifically engaging with its Ig-like domains 1 and 2 through the Fibrinogen C-terminal domain. FGL1 Protein, Mouse (sf9, His) is the recombinant mouse-derived FGL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

FGL1 Protein serves as a potent immune suppressive molecule, exerting its inhibitory effect on antigen-specific T-cell activation as a major ligand for LAG3. It is a crucial contributor to LAG3-mediated T-cell inhibitory functions, and notably, its binding to LAG3 occurs independently of MHC class II. Additionally, FGL1 is secreted by hepatocytes and plays a role in promoting their growth. The protein exists in a homodimeric form and interacts with LAG3 through its Fibrinogen C-terminal domain, specifically engaging with the Ig-like domains 1 and 2 of LAG3.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag C-His
  • Accession

    Q71KU9 (L23-I314)

  • Gene ID
    234199  [NCBI]
  • Molecular Construction
    • N-term
    • FGL1 (L23-I314)
      Accession # Q71KU9
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGL1; Fibrinogen-Like Protein 1; Fibrinogen Like 1; LFIRE-1; HPS; HFREP1; Hepassocin; HP-041; HFREP-1; Hepatocellular Carcinoma-Related Sequence; Hepatocyte-Derived Fibrinogen-Related Protein 1; LFIRE1; Liver Fibrinogen-Related Protein 1

  • AA Sequence

    LESESCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKRQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

  • Predicted Molecular Mass

    35.5 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 25% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FGL1 Protein, Mouse (sf9, His) Product Image
    1/16
  • FGL1 Protein, Mouse (sf9, His) Product Image