FGL1 Protein, Mouse (sf9, His)
Based on 1 Customer Validation
FGL1 Protein, a potent immune suppressive molecule, inhibits antigen-specific T-cell activation as a major ligand for LAG3. It crucially contributes to LAG3-mediated T-cell inhibitory functions, independently of MHC class II. Secreted by hepatocytes, FGL1 also promotes their growth. The homodimeric form of the protein interacts with LAG3, specifically engaging with its Ig-like domains 1 and 2 through the Fibrinogen C-terminal domain. FGL1 Protein, Mouse (sf9, His) is the recombinant mouse-derived FGL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
FGL1 Protein, a potent immune suppressive molecule, inhibits antigen-specific T-cell activation as a major ligand for LAG3. It crucially contributes to LAG3-mediated T-cell inhibitory functions, independently of MHC class II. Secreted by hepatocytes, FGL1 also promotes their growth. The homodimeric form of the protein interacts with LAG3, specifically engaging with its Ig-like domains 1 and 2 through the Fibrinogen C-terminal domain. FGL1 Protein, Mouse (sf9, His) is the recombinant mouse-derived FGL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
FGL1 Protein serves as a potent immune suppressive molecule, exerting its inhibitory effect on antigen-specific T-cell activation as a major ligand for LAG3. It is a crucial contributor to LAG3-mediated T-cell inhibitory functions, and notably, its binding to LAG3 occurs independently of MHC class II. Additionally, FGL1 is secreted by hepatocytes and plays a role in promoting their growth. The protein exists in a homodimeric form and interacts with LAG3 through its Fibrinogen C-terminal domain, specifically engaging with the Ig-like domains 1 and 2 of LAG3.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q71KU9 (L23-I314)
-
Molecular Construction
-
N-term
-
FGL1 (L23-I314)
Accession # Q71KU9 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGL1; Fibrinogen-Like Protein 1; Fibrinogen Like 1; LFIRE-1; HPS; HFREP1; Hepassocin; HP-041; HFREP-1; Hepatocellular Carcinoma-Related Sequence; Hepatocyte-Derived Fibrinogen-Related Protein 1; LFIRE1; Liver Fibrinogen-Related Protein 1
-
AA Sequence
LESESCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKRQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII
-
Predicted Molecular Mass
35.5 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 25% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)