FGL1 Protein, Mouse (sf9, His)

FGL1 Protein, a potent immune suppressive molecule, inhibits antigen-specific T-cell activation as a major ligand for LAG3. It crucially contributes to LAG3-mediated T-cell inhibitory functions, independently of MHC class II. Secreted by hepatocytes, FGL1 also promotes their growth. The homodimeric form of the protein interacts with LAG3, specifically engaging with its Ig-like domains 1 and 2 through the Fibrinogen C-terminal domain. FGL1 Protein, Mouse (sf9, His) is the recombinant mouse-derived FGL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

FGL1 Protein serves as a potent immune suppressive molecule, exerting its inhibitory effect on antigen-specific T-cell activation as a major ligand for LAG3. It is a crucial contributor to LAG3-mediated T-cell inhibitory functions, and notably, its binding to LAG3 occurs independently of MHC class II. Additionally, FGL1 is secreted by hepatocytes and plays a role in promoting their growth. The protein exists in a homodimeric form and interacts with LAG3 through its Fibrinogen C-terminal domain, specifically engaging with the Ig-like domains 1 and 2 of LAG3.

Mouse

Sf9 insect cells

C-His

Q71KU9 (L23-I314)

234199  [NCBI]

Full Length of Mature Protein

LESESCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKRQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 25% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.