Copy Link Print Information

FGL2 Protein, Human (HEK293, hFc-Flag)

Customer Review

Based on 1 Customer Validation

FGL2 protein is involved in immune responses specific to mucosal tissues, regulating physiologic lymphocyte functions. It forms disulfide-linked homotetramers, indicating its quaternary structure. Studying how FGL2 influences lymphocyte functions and its homotetrameric organization can provide insights into its role in mucosal immunity and immune system regulation. FGL2 Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived FGL2 protein, expressed by HEK293 , with N-hFc, N-Flag labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • FGL2 Protein, Human (HEK293, hFc-Flag) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGL2 protein is involved in immune responses specific to mucosal tissues, regulating physiologic lymphocyte functions. It forms disulfide-linked homotetramers, indicating its quaternary structure. Studying how FGL2 influences lymphocyte functions and its homotetrameric organization can provide insights into its role in mucosal immunity and immune system regulation. FGL2 Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived FGL2 protein, expressed by HEK293 , with N-hFc, N-Flag labeled tag.

Background

The FGL2 protein appears to play a role in physiologic lymphocyte functions at mucosal sites, suggesting its involvement in immune responses specific to mucosal tissues. Its potential contribution to lymphocyte functions implies a role in the regulation of immune activities at these specialized sites. Structurally, FGL2 forms homotetramers that are disulfide-linked, highlighting its quaternary structure. Further exploration into the specific mechanisms by which FGL2 influences physiologic lymphocyte functions at mucosal sites and the functional consequences of its homotetrameric organization could provide valuable insights into its role in mucosal immunity and immune system regulation.

Verified Bioactivity

Immobilized Human FGL2, hFc Tag at 1 μg/mL (100 μl/Well) on the plate. Dose response curve for Biotinylated Anti-FGL2 Antibody, hFc Tag with the EC50 of ≤ 34.3 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc;N-Flag
  • Accession

    Q14314 (V205-P439)

  • Gene ID
    10875  [NCBI]
  • Protein Length

    Full Length of Fibrinogen C-terminal Domain

  • Synonyms

    FGL2; Fibrinogen-Like Protein 2; Fibrinogen Like 2; T49; Fibroleukin; Fibrinogen-Like 2; PT49

  • AA Sequence

    VQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP

  • Molecular Weight

    Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 200 mM Arginine, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FGL2 Protein, Human (HEK293, hFc-Flag) Product Image
    1/16
  • FGL2 Protein, Human (HEK293, hFc-Flag) Product Image