FGL2 Protein, Human (HEK293, His-Avi, Flag)

FGL2 protein is involved in immune responses specific to mucosal tissues, regulating physiologic lymphocyte functions. It forms disulfide-linked homotetramers, indicating its quaternary structure. Studying how FGL2 influences lymphocyte functions and its homotetrameric organization can provide insights into its role in mucosal immunity and immune system regulation. FGL2 Protein, Human (HEK293, His-Avi, Flag) is the recombinant human-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.

The FGL2 protein appears to play a role in physiologic lymphocyte functions at mucosal sites, suggesting its involvement in immune responses specific to mucosal tissues. Its potential contribution to lymphocyte functions implies a role in the regulation of immune activities at these specialized sites. Structurally, FGL2 forms homotetramers that are disulfide-linked, highlighting its quaternary structure. Further exploration into the specific mechanisms by which FGL2 influences physiologic lymphocyte functions at mucosal sites and the functional consequences of its homotetrameric organization could provide valuable insights into its role in mucosal immunity and immune system regulation.

Immobilized Human FGL2, His Tag at 1 μg/ml (100 μl/well) on the plate. Dose response curve for Anti-FGL2 Antibody, hFc Tag with the EC₅₀ of 1.0-5.0 ng/ml determined by ELISA.

Human

HEK293

N-Avi;N-6*His;N-Flag

Q14314 (V205-P439)

10875  [NCBI]

Partial

VQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP

Approximately 40-50 kDa,based on Bis-Tris PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.