FGL2 Protein, Human (HEK293, His-Avi, Flag)
Based on 1 Customer Validation
FGL2 protein is involved in immune responses specific to mucosal tissues, regulating physiologic lymphocyte functions. It forms disulfide-linked homotetramers, indicating its quaternary structure. Studying how FGL2 influences lymphocyte functions and its homotetrameric organization can provide insights into its role in mucosal immunity and immune system regulation. FGL2 Protein, Human (HEK293, His-Avi, Flag) is the recombinant human-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGL2 protein is involved in immune responses specific to mucosal tissues, regulating physiologic lymphocyte functions. It forms disulfide-linked homotetramers, indicating its quaternary structure. Studying how FGL2 influences lymphocyte functions and its homotetrameric organization can provide insights into its role in mucosal immunity and immune system regulation. FGL2 Protein, Human (HEK293, His-Avi, Flag) is the recombinant human-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.
Background
The FGL2 protein appears to play a role in physiologic lymphocyte functions at mucosal sites, suggesting its involvement in immune responses specific to mucosal tissues. Its potential contribution to lymphocyte functions implies a role in the regulation of immune activities at these specialized sites. Structurally, FGL2 forms homotetramers that are disulfide-linked, highlighting its quaternary structure. Further exploration into the specific mechanisms by which FGL2 influences physiologic lymphocyte functions at mucosal sites and the functional consequences of its homotetrameric organization could provide valuable insights into its role in mucosal immunity and immune system regulation.
Verified Bioactivity
Immobilized Human FGL2, His Tag at 1 μg/ml (100 μl/well) on the plate. Dose response curve for Anti-FGL2 Antibody, hFc Tag with the EC50 of 1.0-5.0 ng/ml determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Avi;N-6*His;N-Flag
-
Accession
Q14314 (V205-P439)
-
Protein Length
Full Length of Fibrinogen C-terminal Domain
-
Synonyms
FGL2; Fibrinogen-Like Protein 2; Fibrinogen Like 2; T49; Fibroleukin; Fibrinogen-Like 2; PT49
-
AA Sequence
VQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
-
Predicted Molecular Mass
31.2 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)