FKBP12 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

FKBP12 protein maintains TGFBR1 in an inactive state, inhibits activin signaling by recruiting SMAD7, and modulates RYR1 calcium channel activity. As a PPIase, it speeds up protein folding. FKBP12's multifunctionality underscores its regulatory role in cellular processes, emphasizing its importance in signaling and protein folding. FKBP12, Human (His) is the recombinant human-derived FKBP12 protein, expressed by E. coli, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FKBP12 protein maintains TGFBR1 in an inactive state, inhibits activin signaling by recruiting SMAD7, and modulates RYR1 calcium channel activity. As a PPIase, it speeds up protein folding. FKBP12's multifunctionality underscores its regulatory role in cellular processes, emphasizing its importance in signaling and protein folding. FKBP12, Human (His) is the recombinant human-derived FKBP12 protein, expressed by E. coli, with C-His labeled tag.

Background

FKBP12 protein plays a crucial role in maintaining the inactive conformation of TGFBR1, the serine/threonine kinase receptor for TGF-beta, effectively preventing receptor activation in the absence of ligand. Additionally, FKBP12 recruits SMAD7 to ACVR1B, inhibiting the association of SMAD2 and SMAD3 with the activin receptor complex and thereby blocking activin signaling. This multifunctional protein may also modulate the activity of the RYR1 calcium channel. As a peptidyl-prolyl cis-trans isomerase (PPIase), FKBP12 accelerates the folding of proteins by catalyzing the isomerization of proline imidic peptide bonds in oligopeptides. The diverse functions of FKBP12 highlight its regulatory role in various cellular processes, emphasizing its significance in intracellular signaling and protein folding.

Verified Bioactivity

Measured by its ability to convert the substrate, Suc-AAPF-pNA (HY-P2573), from Cis to Trans formation. The specific activity is ≥2000 pmol/min/μg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FKBP12 (M1-E108)
      Accession # P62942/NP_463460.1
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    FKBP1A; Calstabin-1; Prev. FKBP1; FKBP12C; FKBP-12; FKBP-1A; FKBP12; FK506-Binding Protein, T-Cell, 12-KD; PPIASE; FK506-Binding Protein 1A (12kD); PKC12; Protein Kinase C Inhibitor 2; Peptidyl-Prolyl Cis-Trans Isomerase FKBP1A; FK506 Binding Protein 1A;

  • AA Sequence

    MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

  • Predicted Molecular Mass

    12.8 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00