FOLR1 Protein, Human (HEK293, His-Avi)

The FOLR1 protein is an important mediator of folate uptake, binding to folate and promoting the delivery of 5-methyltetrahydrofolate into cells. Studies show high affinity at neutral pH. FOLR1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived FOLR1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

The FOLR1 protein functions as a key mediator in folate uptake, binding to folate and reduced folic acid derivatives to facilitate the delivery of 5-methyltetrahydrofolate and folate analogs into the cell interior. This process is characterized by a high affinity for folate and folic acid analogs at neutral pH, as evidenced by various studies. Notably, exposure to a slightly acidic pH following receptor endocytosis induces a conformational change that significantly reduces its affinity for folates, facilitating their release. Beyond its role in folate transport, FOLR1 is essential for normal embryonic development and proper cell proliferation, underlining its significance in fundamental cellular processes.

Human

HEK293

C-Avi;C-8*His

P15328 (R25-M233)

2348  [NCBI]

Partial

RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM

Approximately 38-45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.