FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi)
FOLR1 Protein, binding to folate and reduced folic acid derivatives, facilitates their delivery into cells. It maintains high affinity under neutral pH but undergoes a conformational change upon endocytosis, reducing affinity and releasing folates in slightly acidic pH. Crucial for embryonic development, cell proliferation, and renal folate reabsorption. FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived FOLR1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi) is 208 a.a., with molecular weight of 32-45 kDa.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FOLR1 Protein, binding to folate and reduced folic acid derivatives, facilitates their delivery into cells. It maintains high affinity under neutral pH but undergoes a conformational change upon endocytosis, reducing affinity and releasing folates in slightly acidic pH. Crucial for embryonic development, cell proliferation, and renal folate reabsorption. FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived FOLR1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of FOLR1 Protein, Mouse (Biotinylated, HEK293, His-Avi) is 208 a.a., with molecular weight of 32-45 kDa.
Background
The FOLR1 protein binds to folate and reduced folic acid derivatives, facilitating the delivery of 5-methyltetrahydrofolate and folate analogs into cells. It exhibits a high affinity for folate and folic acid analogs under neutral pH conditions. Upon endocytosis and exposure to slightly acidic pH, a conformational change occurs, leading to a significant reduction in its affinity for folates and subsequent release. This protein is essential for normal embryonic development, cell proliferation, and renal folate reabsorption.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P35846 (T25-S232)
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
FOLR1; KB Cells FBP; Prev. FOLR; FBP; Ovarian Tumor-Associated Antigen MOv18; Folate Binding Protein; Adult Folate-Binding Protein; FRalpha; Folate Receptor 1 (Adult); NCFTD; Folate Receptor, Adult; FRα; Folate Receptor 1; FRA; Folate Receptor Alpha; FR-A
-
AA Sequence
TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMS
-
Predicted Molecular Mass
27.1 kDa
-
Molecular Weight
Approximately 35-50 kDa,based on Bis-Tris PAGE under reducing conditions,due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
