FOLR1 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
The FOLR1 protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind folate (vitamin B9) and transport it into cells. FOLR1 Protein, Rat (HEK293, His) is the recombinant rat-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FOLR1 protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind folate (vitamin B9) and transport it into cells. FOLR1 Protein, Rat (HEK293, His) is the recombinant rat-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.
Background
FOLR1 Protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind and transport folate (vitamin B9) into cells. FOLR1 is widely expressed in various tissues, including the placenta, kidney, lung, and intestine. It plays a crucial role in folate metabolism by mediating the cellular uptake of folate. FOLR1 is particularly important during pregnancy, as it facilitates the transport of folate across the placenta to support fetal development. In addition to its role in folate transport, FOLR1 has been implicated in other cellular processes, including cell adhesion, migration, and signaling. It is also being investigated as a potential target for cancer therapy, as FOLR1 expression is frequently upregulated in several types of cancer cells, making it a promising candidate for targeted drug delivery.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
G3V8M6 (T25-M231)
-
Molecular Construction
-
N-term
-
FOLR1 (T25-M231)
Accession # G3V8M6 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
FOLR1; KB Cells FBP; Prev. FOLR; FBP; Ovarian Tumor-Associated Antigen MOv18; Folate Binding Protein; Adult Folate-Binding Protein; FRalpha; Folate Receptor 1 (Adult); NCFTD; Folate Receptor, Adult; FRα; Folate Receptor 1; FRA; Folate Receptor Alpha; FR-A
-
AA Sequence
TRARTELLNVCMDAKHHKEKPGPEDKLHDQCSPWKTNACCSTNTSQEAHKDISYLYRFNWNHCGTMTPECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCVLWWEDCKSSFTCKSNWHKGWNWTSGHNECPVGASCHPFTFYFPTPAVLCEKIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEVM
-
Predicted Molecular Mass
25.7 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
