Copy Link Print Information

FOLR4 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The FOLR4 protein serves as a receptor for IZUMO1 on the egg membrane and plays a crucial role in species-specific gamete recognition and fertilization. The interaction between IZUMO1 and FOLR4 (IZUMO1R/JUNO) is an important adhesion event that is required for fertilization but not sufficient for cell fusion. FOLR4 Protein, Human (HEK293, His) is the recombinant human-derived FOLR4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • FOLR4 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The FOLR4 protein serves as a receptor for IZUMO1 on the egg membrane and plays a crucial role in species-specific gamete recognition and fertilization. The interaction between IZUMO1 and FOLR4 (IZUMO1R/JUNO) is an important adhesion event that is required for fertilization but not sufficient for cell fusion. FOLR4 Protein, Human (HEK293, His) is the recombinant human-derived FOLR4 protein, expressed by HEK293 , with C-His labeled tag.

Background

FOLR4 Protein functions as a receptor for IZUMO1 at the cell surface of oocytes (oolemma), playing a crucial role in species-specific gamete recognition and fertilization. The interaction between IZUMO1 and its receptor FOLR4, known as IZUMO1R/JUNO, is an essential adhesion event between sperm and egg, necessary for fertilization, although it alone is not sufficient for cell fusion. Contrary to its name, FOLR4 does not bind folate, and its ligand-receptor interaction is not classified as a membrane 'fusogen.' Existing as a monomer, FOLR4 directly interacts with IZUMO1, forming a complex with 1:1 stoichiometry. Interestingly, FCRL3/MAIA replaces IZUMO1R/JUNO as the receptor for IZUMO1 after sperm-egg adhesion, facilitating species-specific gamete fusion. These interactions highlight the intricate molecular mechanisms underlying gamete recognition and fusion during the fertilization process.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-8*His
  • Accession

    A6ND01-1 (G20-S228)

  • Gene ID
    390243  [NCBI]
  • Molecular Construction
    • N-term
    • FOLR4 (G20-S228)
      Accession # A6ND01
    • 8*His
    • C-term
  • Protein Length

    Full Length of Sperm-egg fusion protein Juno Chain

  • Synonyms

    IZUMO1R; Folate Receptor Delta; Prev. FOLR4; Folate Receptor 4 (Delta) Homolog (Mouse); JUNO; Folate Receptor 4 (Delta) Homolog; Folbp3; IZUMO1 Receptor, JUNO, FR-Delta; Folate Receptor 4, Delta (Putative); Probable Folate Receptor Delta; Sperm-Egg Fusion

  • AA Sequence

    GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS

  • Predicted Molecular Mass

    25 kDa

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FOLR4 Protein, Human (HEK293, His) Product Image
    1/16
  • FOLR4 Protein, Human (HEK293, His) Product Image