FOS Protein, Human (His, Myc)
Based on 1 Customer Validation
FOS Protein, Human (His, Myc) is the recombinant human-derived FOS, expressed by E. coli , with N-10*His, C-Myc labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FOS Protein, Human (His, Myc) is the recombinant human-derived FOS, expressed by E. coli , with N-10*His, C-Myc labeled tag.
Background
c-Fos is a nuclear phosphoprotein that forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, the basic regions of FOS and JUN/AP-1 each interact with symmetrical DNA half-sites. Upon TGF-beta activation, it forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. It plays a critical role in regulating the development of cells destined to form and maintain the skeleton and is thought to be important in signal transduction, cell proliferation, and differentiation. In growing cells, c-Fos activates phospholipid synthesis, likely by activating CDS1 and PI4K2A, an activity that requires Tyr dephosphorylation and association with the endoplasmic reticulum.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
P01100-1 (M1-L380)
-
Gene ID2353
-
Protein Length
Full Length of Isoform-1
-
Synonyms
FOS; FBJ Murine Osteosarcoma Viral (V-Fos) Oncogene Homolog (Oncogene FOS); Fos Proto-Oncogene, AP-1 Transcription Factor Subunit; V-Fos FBJ Murine Osteosarcoma Viral Oncogene Homolog; Protein C-Fos; Fos Proto-Oncogene, AP-1 Trancription Factor Subunit; C
-
AA Sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
-
Predicted Molecular Mass
45.7 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
