Copy Link Print Information

Fractalkine/CX3CL1 Protein, Rat

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Fractalkine/CX3CL1 protein is a versatile chemokine that acts as a ligand for CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. It regulates immune response, inflammation, adhesion, and chemotaxis. It activates integrins via CX3CR1-dependent and -independent pathways, binding to site 1 with CX3CR1 and site 2 without CX3CR1. Soluble Fractalkine/CX3CL1 attracts T-cells and monocytes, not neutrophils. Fractalkine/CX3CL1 Protein, Rat is the recombinant rat-derived Fractalkine/CX3CL1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Fractalkine/CX3CL1 Protein, Rat
  • Experimental Validation Results for Fractalkine/CX3CL1 Protein, Rat
  • Fractalkine/CX3CL1 Protein, Rat Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Fractalkine/CX3CL1 protein is a versatile chemokine that acts as a ligand for CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. It regulates immune response, inflammation, adhesion, and chemotaxis. It activates integrins via CX3CR1-dependent and -independent pathways, binding to site 1 with CX3CR1 and site 2 without CX3CR1. Soluble Fractalkine/CX3CL1 attracts T-cells and monocytes, not neutrophils. Fractalkine/CX3CL1 Protein, Rat is the recombinant rat-derived Fractalkine/CX3CL1 protein, expressed by E. coli , with tag free.

Background

Fractalkine/CX3CL1 protein serves as a multifaceted chemokine, acting as a ligand for both CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. The CX3CR1-CX3CL1 signaling cascade exhibits diverse functions across various tissue compartments, encompassing roles in immune response modulation, inflammation regulation, cell adhesion, and chemotaxis. Specifically, it plays a crucial role in regulating leukocyte adhesion and migration processes at the endothelium. Fractalkine/CX3CL1 demonstrates the ability to activate integrins in a CX3CR1-dependent and CX3CR1-independent manner. In the presence of CX3CR1, it activates integrins by binding to the classical ligand-binding site (site 1) in integrins. Conversely, in the absence of CX3CR1, it binds to a distinct site (site 2) on integrins, enhancing the binding of other integrin ligands to site 1. The soluble form of Fractalkine/CX3CL1 exhibits chemotactic properties for T-cells and monocytes, though not for neutrophils.

Verified Bioactivity

1.Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 5.736 ng/mL, corresponding to a specific activity is 1.74×105 U/mg.
2.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CX3CR1. The ED50 for this effect is 5-10 ng/mL, corresponding to a specific activity is 1.46×105 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50 this effect is 5.736 ng/mL, corresponding to a specific activity is 1.74×105 U/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession

    O55145 (L22-G100)

  • Gene ID
    89808  [NCBI]
  • Molecular Construction
    • N-term
    • Fractalkine (L22-G100)
      Accession # O55145
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    CX3CL1; NTN; Prev. SCYD1; CX3C Membrane-Anchored Chemokine; Chemokine (C-X3-C Motif) Ligand 1; Small-Inducible Cytokine D1; Fractalkine; C-X3-C Motif Chemokine 1; Neurotactin; NTT; C3Xkine; Small Inducible Cytokine Subfamily D (Cys-X3-Cys), Member-1; ABCD

  • AA Sequence

    LAGQHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNG

  • Predicted Molecular Mass

    9 kDa

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50 this effect is 5.736 ng/mL, corresponding to a specific activity is 1.74×105 U/mg.

  • Fractalkine/CX3CL1 Protein, Rat Product Image
    1/16
  • Experimental Validation Results for Fractalkine/CX3CL1 Protein, Rat
  • Experimental Validation Results for Fractalkine/CX3CL1 Protein, Rat
  • Fractalkine/CX3CL1 Protein, Rat Product Image