Fractalkine/CX3CL1 Protein, Rat

Fractalkine/CX3CL1 protein is a versatile chemokine that acts as a ligand for CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. It regulates immune response, inflammation, adhesion, and chemotaxis. It activates integrins via CX3CR1-dependent and -independent pathways, binding to site 1 with CX3CR1 and site 2 without CX3CR1. Soluble Fractalkine/CX3CL1 attracts T-cells and monocytes, not neutrophils. Fractalkine/CX3CL1 Protein, Rat is the recombinant rat-derived Fractalkine/CX3CL1 protein, expressed by E. coli , with tag free.

Fractalkine/CX3CL1 protein serves as a multifaceted chemokine, acting as a ligand for both CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. The CX3CR1-CX3CL1 signaling cascade exhibits diverse functions across various tissue compartments, encompassing roles in immune response modulation, inflammation regulation, cell adhesion, and chemotaxis. Specifically, it plays a crucial role in regulating leukocyte adhesion and migration processes at the endothelium. Fractalkine/CX3CL1 demonstrates the ability to activate integrins in a CX3CR1-dependent and CX3CR1-independent manner. In the presence of CX3CR1, it activates integrins by binding to the classical ligand-binding site (site 1) in integrins. Conversely, in the absence of CX3CR1, it binds to a distinct site (site 2) on integrins, enhancing the binding of other integrin ligands to site 1. The soluble form of Fractalkine/CX3CL1 exhibits chemotactic properties for T-cells and monocytes, though not for neutrophils.

1.Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 5.736 ng/mL, corresponding to a specific activity is 1.74×10⁵ U/mg.
2.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CX3CR1. The ED₅₀ for this effect is 5-10 ng/mL, corresponding to a specific activity is 1.46×10⁵ U/mg.

• 
  Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED₅₀ this effect is 5.736 ng/mL, corresponding to a specific activity is 1.74×10⁵ U/mg.

Rat

E. coli

Tag Free

O55145 (L22-G100)

89808  [NCBI]

Partial

LAGQHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNG

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.