Frizzled-8 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Frizzled-8 is a Wnt receptor that critically coordinates β-catenin signaling through the complex Wnt-Fzd-LRP5-LRP6 complex. It acts through the canonical Wnt/β-catenin pathway, activating scrambled proteins, inhibiting GSK-3 kinase, inducing nuclear β-catenin accumulation, and activating Wnt target genes. Frizzled-8 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-8 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Frizzled-8 is a Wnt receptor that critically coordinates β-catenin signaling through the complex Wnt-Fzd-LRP5-LRP6 complex. It acts through the canonical Wnt/β-catenin pathway, activating scrambled proteins, inhibiting GSK-3 kinase, inducing nuclear β-catenin accumulation, and activating Wnt target genes. Frizzled-8 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-8 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Frizzled-8, functioning as a receptor for Wnt proteins, plays a pivotal role in the intricate Wnt-Fzd-LRP5-LRP6 complex, orchestrating beta-catenin signaling by inducing the aggregation of receptor-ligand complexes into signalosomes of ribosome size. Operating primarily through the canonical Wnt/beta-catenin signaling pathway, it prompts the activation of disheveled proteins, inhibits GSK-3 kinase, facilitates nuclear accumulation of beta-catenin, and activates Wnt target genes. An additional signaling pathway involving PKC and calcium fluxes has been observed in some family members, although the extent of its integration with the canonical pathway remains unclear. Frizzled-8 may contribute to transducing polarity information during tissue morphogenesis and in differentiated tissues. As a coreceptor alongside RYK for Wnt proteins like WNT1, it actively participates in the formation of a Wnt-signaling complex, engaging with WNT proteins, FZD proteins, and LRP5 or LRP6. The interactions with GPOC, RSPO1, RSPO3, and glypican GPC3 further underscore its intricate involvement in diverse cellular processes.

Verified Bioactivity

1.Immobilized Recombinant Human Frizzled-8 (C-6*His) at 2 μg/ml (100 μl/well) can bind Human Frizzled receptors Antibody(Vantictumab,Research Grade). The ED50 of Human Frizzled receptors Antibody(Vantictumab,Research Grade) is 10-50 ng/mL.
2.Loaded Human Frizzled receptors Antibody (Vantictumab, Research Grade) on Pro-A Biosensor, can bind Recombinant Human Frizzled-8 (C-6*His) with an affinity constant of 0.1183-4.24 μM as determined in BLI assay.

MCE Validation Data

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Vantictumab (HY-P9974) on AHC2 biosensor, can bind Frizzled-8 Protein, Human (HEK293, His) with an affinity constant of 1.183E-07 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Frizzled-8 (A28-P172)
      Accession # Q9H461
    • 6*His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    FZD8; Frizzled (Drosophila) Homolog 8; Frizzled Class Receptor 8; Frizzled Homolog 8 (Drosophila); Frizzled-8; Frizzled Homolog 8; FZ-8; HFZ8; Frizzled 8, Seven Transmembrane Spanning Receptor; HFz8; Frizzled Family Receptor 8; Fz-8

  • AA Sequence

    ASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPP

  • Predicted Molecular Mass

    17.3 kDa

  • Molecular Weight

    Approximately 22-32 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00