1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled
  5. Frizzled-8
  6. Frizzled-8 Protein, Human (HEK293, His)

Frizzled-8 is a Wnt receptor that critically coordinates β-catenin signaling through the complex Wnt-Fzd-LRP5-LRP6 complex. It acts through the canonical Wnt/β-catenin pathway, activating scrambled proteins, inhibiting GSK-3 kinase, inducing nuclear β-catenin accumulation, and activating Wnt target genes. Frizzled-8 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-8 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Frizzled-8 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Frizzled-8 is a Wnt receptor that critically coordinates β-catenin signaling through the complex Wnt-Fzd-LRP5-LRP6 complex. It acts through the canonical Wnt/β-catenin pathway, activating scrambled proteins, inhibiting GSK-3 kinase, inducing nuclear β-catenin accumulation, and activating Wnt target genes. Frizzled-8 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-8 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Frizzled-8, functioning as a receptor for Wnt proteins, plays a pivotal role in the intricate Wnt-Fzd-LRP5-LRP6 complex, orchestrating beta-catenin signaling by inducing the aggregation of receptor-ligand complexes into signalosomes of ribosome size. Operating primarily through the canonical Wnt/beta-catenin signaling pathway, it prompts the activation of disheveled proteins, inhibits GSK-3 kinase, facilitates nuclear accumulation of beta-catenin, and activates Wnt target genes. An additional signaling pathway involving PKC and calcium fluxes has been observed in some family members, although the extent of its integration with the canonical pathway remains unclear. Frizzled-8 may contribute to transducing polarity information during tissue morphogenesis and in differentiated tissues. As a coreceptor alongside RYK for Wnt proteins like WNT1, it actively participates in the formation of a Wnt-signaling complex, engaging with WNT proteins, FZD proteins, and LRP5 or LRP6. The interactions with GPOC, RSPO1, RSPO3, and glypican GPC3 further underscore its intricate involvement in diverse cellular processes.

Biological Activity

1.Immobilized Recombinant Human Frizzled-8 (C-6*His) at 2 μg/ml (100 μl/well) can bind Human Frizzled receptors Antibody(Vantictumab,Research Grade). The ED50 of Human Frizzled receptors Antibody(Vantictumab,Research Grade) is 10-50 ng/mL.
2.Loaded Human Frizzled receptors Antibody (Vantictumab, Research Grade) on Pro-A Biosensor, can bind Recombinant Human Frizzled-8 (C-6*His) with an affinity constant of 0.1183-4.24 μM as determined in BLI assay.

  • Loaded Vantictumab (HY-P9974) on AHC2 biosensor, can bind Frizzled-8 Protein, Human (HEK293, His) with an affinity constant of 1.183E-07 M as determined in BLI assay.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9H461 (A28-P172)

Gene ID
Molecular Construction
N-term
Frizzled-8 (A28-P172)
Accession # Q9H461
6*His
C-term
Protein Length

Partial

Synonyms
frizzled 8; frizzled family receptor 8; Frizzled8; Frizzled-8; FZ-8; FZD8; hFZ8
AA Sequence

ASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPP

Molecular Weight

Approximately 22-32 kDa, based on SDS-PAGE under reducing condition.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Frizzled-8 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Frizzled-8 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-8 Protein, Human (HEK293, His)
Cat. No.:
HY-P70915
Quantity:
MCE Japan Authorized Agent: