FSH beta Protein, Human (HEK293, His)
Based on 1 Customer Validation
The FSH beta protein and the alpha chain CGA form follicle-stimulating hormone, which gives the hormone heterodimer biological specificity. It binds to FSHR on target cells and initiates downstream signaling, which is critical for follicle development and spermatogenesis. FSH beta Protein, Human (HEK293, His) is the recombinant human-derived FSH beta protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FSH beta protein and the alpha chain CGA form follicle-stimulating hormone, which gives the hormone heterodimer biological specificity. It binds to FSHR on target cells and initiates downstream signaling, which is critical for follicle development and spermatogenesis. FSH beta Protein, Human (HEK293, His) is the recombinant human-derived FSH beta protein, expressed by HEK293 , with C-6*His labeled tag.
Background
FSH beta Protein, in conjunction with the alpha chain CGA, forms follitropin, the follicle-stimulating hormone, conferring its biological specificity to the hormone heterodimer. This protein binds to FSHR, a G protein-coupled receptor on target cells, initiating downstream signaling pathways. Follitropin plays a crucial role in follicle development and spermatogenesis in reproductive organs. Structured as a heterodimer, the active follitropin consists of an alpha chain/CGA shared with other hormones and a distinctive beta chain/FSHB. Through its interaction with FSHR, FSH beta Protein contributes to the regulation of reproductive processes, highlighting its significance in the intricate orchestration of fertility and reproductive health.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P01225 (N19-E129)
-
Molecular Construction
-
N-term
-
FSH beta (N19-E129)
Accession # P01225 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FSHB; Follitropin Beta Chain; Follicle Stimulating Hormone Subunit Beta; FSH-Beta; Follitropin Subunit Beta; FSH-B; Follicle Stimulating Hormone, Beta Polypeptide; Follicle Stimulating Hormone Beta Subunit; Follicle-Stimulating Hormone Beta Subunit; HH24;
-
AA Sequence
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
-
Predicted Molecular Mass
13.5 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
