Copy Link Print Information

G6B Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for G6B Protein, Human (HEK293, His)
  • Experimental Validation Results for G6B Protein, Human (HEK293, His)
  • G6B Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

Background

G6B, an inhibitory receptor, plays a crucial role in regulating hematopoietic lineage differentiation, megakaryocyte function, and platelet production. This regulatory function extends to inhibiting platelet aggregation and activation induced by various agonists like ADP and collagen-related peptide. The inhibition is mediated through the receptor's impact on CLEC1B and GP6:FcRgamma signaling, involving two immunoreceptor tyrosine-based inhibitor motifs (ITIMs). Notably, G6B operates in a calcium-independent manner. Isoform B, containing both a transmembrane region and the mentioned ITIMs, serves as the inhibitory counterpart, while isoform A is considered the activating counterpart of isoform B. This dual-isoform system reflects the nuanced regulatory mechanisms underlying hematopoiesis and platelet function.

Verified Bioactivity

Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 2.344 μg/mL, corresponding to a specific activity is 4.266×10^2 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 2.344 μg/mL, corresponding to a specific activity is 4.266×102 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O95866-1/NP_612116.1 (N18-Q142)

  • Gene ID
    80739  [NCBI]
  • Molecular Construction
    • N-term
    • G6B (N18-Q142)
      Accession # O95866-1/NP_612116.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    MPIG6B; CDNA FLJ35073 Fis, Clone PLACE6000630; Prev. C6orf25; Immunoglobulin Receptor; G6b-B; C6orf25 Protein; NG31; THAMY; G6b; G6B-B; Protein G6b; G6B; Chromosome 6 Open Reading Frame 25, Isoform CRA_h; Megakaryocyte And Platelet Inhibitory Receptor G6b

  • AA Sequence

    NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

  • Molecular Weight

    Approximately 18-23 kDa due to the glycosylation

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 2.344 μg/mL, corresponding to a specific activity is 4.266×102 U/mg.

  • G6B Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for G6B Protein, Human (HEK293, His)
  • Experimental Validation Results for G6B Protein, Human (HEK293, His)
  • G6B Protein, Human (HEK293, His) Product Image