GABARAP Protein, Human (GST)
Based on 1 Customer Validation
GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA(A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (GST) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA(A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (GST) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-GST labeled tag.
GABARAP (Gamma-aminobutyric acid receptor-associated protein) is a protein that serves multiple functions within the cell. It acts as a ubiquitin-like modifier, participating in the intracellular transport of GABA(A) receptors and interacting with the cytoskeleton. GABARAP is involved in autophagy, specifically in the later stages of autophagosome maturation. It interacts with the reticulophagy receptor TEX264 to remodel subdomains of the endoplasmic reticulum into autophagosomes, which then merge with lysosomes for turnover of the endoplasmic reticulum. GABARAP is also essential for the local activation of the CUL3(KBTBD6/7) E3 ubiquitin ligase complex, which regulates the ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor. This degradation of TIAM1 affects downstream signal transduction pathways involved in cell migration, proliferation, and cytoskeleton organization. Additionally, GABARAP has been implicated in apoptosis. Overall, GABARAP plays a vital role in various biological processes, including intracellular transport, autophagy, cytoskeleton organization, and cell signaling.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q6IAW1 (M1-L117)
-
Molecular Construction
-
N-term
-
GST
-
GABARAP (M1-L117)
Accession # Q6IAW1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GABARAP; Epididymis Secretory Sperm Binding Protein; GABA Type A Receptor-Associated Protein; GABARAP-A; GABA(A) Receptor-Associated Protein; HCG1987397, Isoform CRA_b; MM46; GABARAP Protein; ATG8A; FLC3B; Gamma-Aminobutyric Acid Receptor-Associated Prote
-
AA Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
-
Predicted Molecular Mass
39.4 kDa
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)