GABARAP Protein, Human (His-MBP)
GABARAP Protein is essential for regulating ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor (GEF) involved in RAC1 activation and downstream signaling. The D6/7 E3 ubiquitin ligase complex, where GABARAP is a key component, contributes to diverse biological processes, including cytoskeletal organization, cell migration, proliferation, and apoptosis. GABARAP Protein, Human (His-MBP) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-His, N-MBP labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GABARAP Protein is essential for regulating ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor (GEF) involved in RAC1 activation and downstream signaling. The D6/7 E3 ubiquitin ligase complex, where GABARAP is a key component, contributes to diverse biological processes, including cytoskeletal organization, cell migration, proliferation, and apoptosis. GABARAP Protein, Human (His-MBP) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-His, N-MBP labeled tag.
Background
The D6/7 E3 ubiquitin ligase complex is responsible for regulating the process of ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor (GEF) that activates RAC1 and downstream signal transduction. This complex plays a role in various biological processes including the organization of the cytoskeleton, cell migration, proliferation, and apoptosis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-MBP
-
Accession
O95166 (M1-L117)
-
Molecular Construction
-
N-term
-
His-MBP
-
GABARAP (M1-L117)
Accession # O95166 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GABARAP; Epididymis Secretory Sperm Binding Protein; GABA Type A Receptor-Associated Protein; GABARAP-A; GABA(A) Receptor-Associated Protein; HCG1987397, Isoform CRA_b; MM46; GABARAP Protein; ATG8A; FLC3B; Gamma-Aminobutyric Acid Receptor-Associated Prote
-
AA Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
-
Predicted Molecular Mass
57.5 kDa
-
Molecular Weight
Approximately 49-58 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
