GADD45B Protein, Human (His)

GADD45B Protein, a pivotal mediator, regulates growth and apoptosis by activating the MTK1/MEKK4 MAPKKK signaling pathway. Interacting with GADD45GIP1, it forms a complex that modulates cellular responses under stress. Its central role in growth and apoptosis underscores its significance in orchestrating cellular processes, positioning GADD45B as a key player in the intricate network of signaling pathways governing cell fate decisions. GADD45B Protein, Human (His) is the recombinant human-derived GADD45B protein, expressed by E. coli , with N-6*His labeled tag. The total length of GADD45B Protein, Human (His) is 160 a.a., with molecular weight of ~24.0 kDa.

The GADD45B Protein plays a crucial role in the regulation of both growth and apoptosis, acting as a mediator in the activation of the stress-responsive MTK1/MEKK4 MAPKKK signaling pathway. Through its interactions, GADD45B associates with GADD45GIP1, forming a molecular complex that may contribute to the modulation of cellular responses under stress conditions. The involvement of GADD45B in growth regulation and apoptosis underscores its significance in orchestrating cellular processes in response to various stress stimuli, making it a key player in the intricate network of signaling pathways that govern cell fate decisions.

Human

E. coli

N-6*His

O75293 (M1-R160)

4616  [NCBI]

MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Approximately 24.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.