GADD45B Protein, Human (His)
Based on 1 Customer Validation
GADD45B Protein, a pivotal mediator, regulates growth and apoptosis by activating the MTK1/MEKK4 MAPKKK signaling pathway. Interacting with GADD45GIP1, it forms a complex that modulates cellular responses under stress. Its central role in growth and apoptosis underscores its significance in orchestrating cellular processes, positioning GADD45B as a key player in the intricate network of signaling pathways governing cell fate decisions. GADD45B Protein, Human (His) is the recombinant human-derived GADD45B protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
GADD45B Protein, a pivotal mediator, regulates growth and apoptosis by activating the MTK1/MEKK4 MAPKKK signaling pathway. Interacting with GADD45GIP1, it forms a complex that modulates cellular responses under stress. Its central role in growth and apoptosis underscores its significance in orchestrating cellular processes, positioning GADD45B as a key player in the intricate network of signaling pathways governing cell fate decisions. GADD45B Protein, Human (His) is the recombinant human-derived GADD45B protein, expressed by E. coli , with N-6*His labeled tag.
Background
The GADD45B Protein plays a crucial role in the regulation of both growth and apoptosis, acting as a mediator in the activation of the stress-responsive MTK1/MEKK4 MAPKKK signaling pathway. Through its interactions, GADD45B associates with GADD45GIP1, forming a molecular complex that may contribute to the modulation of cellular responses under stress conditions. The involvement of GADD45B in growth regulation and apoptosis underscores its significance in orchestrating cellular processes in response to various stress stimuli, making it a key player in the intricate network of signaling pathways that govern cell fate decisions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O75293 (M1-R160)
-
Molecular Construction
-
N-term
-
6*His
-
GADD45B (M1-R160)
Accession # O75293 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GADD45B; Growth Arrest And DNA-Damage-Inducible Beta; Prev. MYD118; DKFZP566B133; GADD45BETA; Growth Arrest And DNA-Damage-Inducible, Beta; Growth Arrest And DNA Damage-Inducible Protein GADD45 Beta; Myeloid Differentiation Primary Response; Myeloid Diffe
-
AA Sequence
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)