GADD45G/DDIT2 Protein, Human (His)
GADD45G/DDIT2 protein is a key mediator that regulates growth and apoptosis through the MTK1/MEKK4 MAPKKK signaling pathway. Concentration-dependent homodimerization enhances its growth inhibitory activity and interaction with PCNA, suggesting a role in DNA repair. GADD45G/DDIT2 Protein, Human (His) is the recombinant human-derived GADD45G/DDIT2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GADD45G/DDIT2 protein is a key mediator that regulates growth and apoptosis through the MTK1/MEKK4 MAPKKK signaling pathway. Concentration-dependent homodimerization enhances its growth inhibitory activity and interaction with PCNA, suggesting a role in DNA repair. GADD45G/DDIT2 Protein, Human (His) is the recombinant human-derived GADD45G/DDIT2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
The GADD45G/DDIT2 Protein plays a pivotal role in the regulation of both growth and apoptosis, acting as a mediator in the activation of the stress-responsive MTK1/MEKK4 MAPKKK signaling pathway. The protein undergoes concentration-dependent homodimerization, a crucial aspect for its growth inhibitory activity, and this homodimerization enhances its interaction with PCNA. GADD45G/DDIT2 further interacts with GADD45GIP1, forming a molecular complex that likely contributes to the modulation of cellular responses, particularly under stress conditions. Additionally, its interaction with PCNA suggests a role in DNA repair processes, highlighting the multifaceted functions of GADD45G/DDIT2 in coordinating cellular responses to stress and influencing essential pathways that govern growth and apoptosis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O95257 (M1-E159)
-
Molecular Construction
-
N-term
-
6*His
-
GADD45G (M1-E159)
Accession # O95257 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GADD45G; Growth Arrest And DNA-Damage-Inducible Gamma; Growth Arrest And DNA Damage Inducible Gamma; DNA Damage-Inducible Transcript 2 Protein; DDIT2; Cytokine-Responsive Protein CR6; CR6; Gadd-Related Protein, 17 KD; Growth Arrest And DNA Damage-Inducibl
-
AA Sequence
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
-
Predicted Molecular Mass
19.3 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
