1. Recombinant Proteins
  2. Others
  3. GAP43 Protein, Human (HEK293, His)

The GAP43 protein plays a central role in nerve growth and is found primarily in the active "growth cones" at the tips of axons. It induces axonal and dendritic filopodia, which are critical for neurodevelopmental dynamics. GAP43 Protein, Human (HEK293, His) is the recombinant human-derived GAP43 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GAP43 protein plays a central role in nerve growth and is found primarily in the active "growth cones" at the tips of axons. It induces axonal and dendritic filopodia, which are critical for neurodevelopmental dynamics. GAP43 Protein, Human (HEK293, His) is the recombinant human-derived GAP43 protein, expressed by HEK293 , with C-His labeled tag.

Background

GAP43 protein is intricately associated with nerve growth, emerging as a major component within the motile 'growth cones' that form at the tips of elongating axons. Its pivotal role extends to the induction of axonal and dendritic filopodia, contributing to the dynamic processes crucial for nerve development. Within a molecular context, GAP43 is identified in a complex containing FGFR4, NCAM1, CDH2, PLCG1, FRS2, SRC, SHC1, and CTTN, suggesting its participation in diverse signaling pathways. Additionally, GAP43 exhibits interactions with calmodulin, mediated by its IQ domain, binding calmodulin with greater affinity in the absence of Ca(2+) than in its presence. These intricate molecular associations underscore the multifaceted involvement of GAP43 in nerve growth and signaling cascades, shedding light on its significance in orchestrating axonal dynamics and filopodia formation.

Species

Human

Source

HEK293

Tag

C-His

Accession

P17677-1 (M1-A238)

Gene ID
Molecular Construction
N-term
GAP43 (M1-A238)
Accession # P17677-1
His
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Neuromodulin; pp46; GAP43; B-50
AA Sequence

MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

Molecular Weight

Approximately 47 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GAP43 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GAP43 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GAP43 Protein, Human (HEK293, His)
Cat. No.:
HY-P75175
Quantity:
MCE Japan Authorized Agent: