GAP43 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The GAP43 protein plays a central role in nerve growth and is found primarily in the active "growth cones" at the tips of axons. It induces axonal and dendritic filopodia, which are critical for neurodevelopmental dynamics. GAP43 Protein, Human (HEK293, His) is the recombinant human-derived GAP43 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The GAP43 protein plays a central role in nerve growth and is found primarily in the active "growth cones" at the tips of axons. It induces axonal and dendritic filopodia, which are critical for neurodevelopmental dynamics. GAP43 Protein, Human (HEK293, His) is the recombinant human-derived GAP43 protein, expressed by HEK293 , with C-His labeled tag.
GAP43 protein is intricately associated with nerve growth, emerging as a major component within the motile 'growth cones' that form at the tips of elongating axons. Its pivotal role extends to the induction of axonal and dendritic filopodia, contributing to the dynamic processes crucial for nerve development. Within a molecular context, GAP43 is identified in a complex containing FGFR4, NCAM1, CDH2, PLCG1, FRS2, SRC, SHC1, and CTTN, suggesting its participation in diverse signaling pathways. Additionally, GAP43 exhibits interactions with calmodulin, mediated by its IQ domain, binding calmodulin with greater affinity in the absence of Ca(2+) than in its presence. These intricate molecular associations underscore the multifaceted involvement of GAP43 in nerve growth and signaling cascades, shedding light on its significance in orchestrating axonal dynamics and filopodia formation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P17677-1 (M1-A238)
-
Molecular Construction
-
N-term
-
GAP43 (M1-A238)
Accession # P17677-1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
GAP43; PP46; Growth Associated Protein 43; Neuron Growth-Associated Protein 43; Axonal Membrane Protein GAP-43; Nerve Growth-Related Peptide GAP43; Neuromodulin; Calmodulin-Binding Protein P-57; Neural Phosphoprotein B-50; Growth-Associated Protein 43; GA
-
AA Sequence
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
-
Predicted Molecular Mass
26.2 kDa
-
Molecular Weight
Approximately 47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
