GDF-8 Protein, Human/Mouse/Rat (CHO)
Based on 1 Customer Validation
GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human (CHO) is the recombinant human-derived GDF-8 protein, expressed by CHO, with tag free.
- Species: Rat; Mouse; Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human (CHO) is the recombinant human-derived GDF-8 protein, expressed by CHO, with tag free.
GDF-8 (Growth Differentiation Factor 8) serves as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and interacts with WFIKKN2, thereby inhibiting the activity of the latter. Additionally, GDF-8 interacts with FST3, contributing to its regulatory role in modulating skeletal muscle growth.
Measured by its binding ability in a functional ELISA. Immobilized Human / Mouse / Rat GDF-8 Protein, Tag Free at 1 μg/mL (100 μL/well) can bind Biotinylated Human Activin RIIB Protein, Fc,Avitag with a linear range of 0.1-8 ng/mL.
Technical Parameters
-
Species Rat; Mouse; Human
-
Source CHO
-
Tag Tag Free
-
Accession
O14793 (D267-S375)
-
Gene ID2660
-
Molecular Construction
-
N-term
-
GDF-8 (D267-S375)
Accession # O14793 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MSTN; GDF-8; Prev. GDF8; Myostatin-B; Growth/Differentiation Factor 8; MSLHP; Myostatin; Growth Differentiation Factor 8
-
AA Sequence
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
-
Predicted Molecular Mass
12.4 kDa
-
Molecular Weight
Approximately 12 kDa under reduced (R) conditions, 11 kDa & 25 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22 μm filtered solution of 50 mM HAC, pH 3.0 with 10% trehalose as protectant.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
