1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Growth Differentiation Factor
  5. Growth Differentiation Factor-8 (GDF-8)
  6. GDF-8 Protein, Human (CHO)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human (CHO) is the recombinant human-derived GDF-8 protein, expressed by CHO, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human (CHO) is the recombinant human-derived GDF-8 protein, expressed by CHO, with tag free.

Background

GDF-8 (Growth Differentiation Factor 8) serves as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and interacts with WFIKKN2, thereby inhibiting the activity of the latter. Additionally, GDF-8 interacts with FST3, contributing to its regulatory role in modulating skeletal muscle growth.

Species

Human

Source

CHO

Tag

Tag Free

Accession

O14793 (D267-S375)

Gene ID

2660

Molecular Construction
N-term
GDF-8 (D267-S375)
Accession # O14793
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Growth/differentiation factor 8; GDF-8; Myostatin; MSTN
AA Sequence

DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Predicted Molecular Mass
12.4 kDa.
Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of 50 mM HAC, pH3.0 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GDF-8 Protein, Human (CHO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-8 Protein, Human (CHO)
Cat. No.:
HY-P704631
Quantity:
MCE Japan Authorized Agent: