GFER Protein, Human (HEK293, His, solution)
Based on 1 Customer Validation
GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His, solution) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His, solution) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.
Background
GFER protein functions as an autocrine hepatotrophic growth factor that plays a critical role in promoting liver regeneration.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P55789-2 (M1-D125)
-
Molecular Construction
-
N-term
-
GFER (M1-D125)
Accession # P55789-2 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
GFER; Growth Factor, Erv1 (S. Cerevisiae)-Like (Augmenter Of Liver Regeneration); Growth Factor, Augmenter Of Liver Regeneration; Augmenter Of Liver Regeneration; HERV1; ERV1 Homolog (S. Cerevisiae); ALR; Erv1-Like Growth Factor; FAD-Linked Sulfhydryl Oxi
-
AA Sequence
MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
-
Predicted Molecular Mass
16.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, 5% Trehalose, 8% Glycerol, 0.02% Tween-80, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
