GGACT Protein, Human (His)
Based on 1 Customer Validation
The GGACT protein uses its enzymatic activity to break cross-links between lysine and glutamate residues, actively promoting the degradation of proteins cross-linked by transglutaminase. In addition, GGACT catalyzes the formation of 5-oxo-L-proline from the substrate L-γ-glutamyl-L-ε-lysine. GGACT Protein, Human (His) is the recombinant human-derived GGACT protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GGACT protein uses its enzymatic activity to break cross-links between lysine and glutamate residues, actively promoting the degradation of proteins cross-linked by transglutaminase. In addition, GGACT catalyzes the formation of 5-oxo-L-proline from the substrate L-γ-glutamyl-L-ε-lysine. GGACT Protein, Human (His) is the recombinant human-derived GGACT protein, expressed by E. coli , with N-6*His labeled tag.
Background
GGACT (Gamma-glutamylamine cyclotransferase), also known as 5-oxoprolinase, plays a crucial role in the degradation of proteins cross-linked by transglutaminases by cleaving the cross-link between a lysine and a glutamic acid residue. Additionally, GGACT catalyzes the formation of 5-oxo-L-proline from L-gamma-glutamyl-L-epsilon-lysine. Notably, GGACT exhibits inactivity with substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine, suggesting substrate specificity in its enzymatic activity. The enzyme's ability to target specific cross-linked protein structures highlights its importance in cellular processes associated with protein turnover and degradation.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9BVM4 (M1-R153)
-
Molecular Construction
-
N-term
-
6*His
-
GGACT (M1-R153)
Accession # Q9BVM4 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GGACT; AIG2-Like Domain-Containing Protein 1; Prev. A2LD1; AIG2-Like Domain 1; Gamma-Glutamylamine Cyclotransferase; Gamma-Glutamylaminecyclotransferase
-
AA Sequence
MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR
-
Predicted Molecular Mass
19.5 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Succinate, 50 mM NaCl, 8% trehalose, 0.02% Tween 20, pH 4.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
