GLIPR1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
GLIPR1 protein is a member of the CRISP (cysteine-rich secreted protein) family and is a multifunctional protein involved in a variety of cellular processes. It is primarily known for its role in cancer development and progression. GLIPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GLIPR1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
GLIPR1 protein is a member of the CRISP (cysteine-rich secreted protein) family and is a multifunctional protein involved in a variety of cellular processes. It is primarily known for its role in cancer development and progression. GLIPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GLIPR1 protein, expressed by HEK293 , with C-His labeled tag.
Background
GLIPR1 Protein, a member of the CRISP (cysteine-rich secretory protein) family, is a multifunctional protein involved in various cellular processes. It is primarily known for its role in cancer development and progression. GLIPR1 Protein has been implicated in regulating apoptosis (programmed cell death), cell proliferation, and cell migration. In cancer cells, GLIPR1 Protein can act as both a tumor suppressor or an oncogene, depending on the context. It can induce apoptosis and inhibit tumor growth in certain types of cancer, while promoting tumor cell survival and metastasis in others. Additionally, GLIPR1 Protein has been shown to modulate immune responses and contribute to the regulation of inflammation. Further research is needed to fully elucidate the mechanisms underlying the diverse functions of GLIPR1 Protein and its potential as a therapeutic target in cancer and other diseases.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q9CWG1/NP_082884.1 (S18-T223)
-
Molecular Construction
-
N-term
-
GLIPR1 (S18-T223)
Accession # Q9CWG1/NP_082884.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
GLIPR1; GliPR 1; GLI Pathogenesis Related 1; CDNA FLJ50386, Highly Similar To Glioma Pathogenesis-Related Protein 1; RTVP1; Related To Testis-Specific, Vespid, And Pathogenesis Proteins 1; GliPR; Testes-Specific Vespid And Pathogenesis Protein 1; Glioma P
-
AA Sequence
SSFTASTLPDITNEDFIKECVQVHNQLRSKVSPPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRHVCGHYTQVVWADSYKLGCAVQLCPNGANFICDYGPAGNYPTWPYKQGATCSDCPKDDKCLNSLCINPRRDQVSRYYSVDYPDWPIYLRNRYT
-
Molecular Weight
Approximately 28-32 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Tiu YC, et al. GLIPR1 promotes proliferation, metastasis and 5-fluorouracil resistance in hepatocellular carcinoma by activating the PI3K/PDK1/ROCK1 pathway. Cancer Gene Ther. 2022 Nov;29(11):1720-1730. [Content Brief]
[2]. Murphy EV, et al. The human glioma pathogenesis-related protein is structurally related to plant pathogenesis-related proteins and its gene is expressed specifically in brain tumors. Gene. 1995 Jun 14;159(1):131-5. [Content Brief]
[3]. Wang J, et al. Glioma pathogenesis-related protein 1 performs dual functions in tumor cells. Cancer Gene Ther. 2022 Mar;29(3-4):253-263. [Content Brief]
[4]. Giladi ND, et al. RTVP-1 promotes mesenchymal transformation of glioma via a STAT-3/IL-6-dependent positive feedback loop. Oncotarget. 2015 Sep 8;6(26):22680-97. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
