GLIPR1 Protein, Mouse (HEK293, His)

GLIPR1 protein is a member of the CRISP (cysteine-rich secreted protein) family and is a multifunctional protein involved in a variety of cellular processes. It is primarily known for its role in cancer development and progression. GLIPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GLIPR1 protein, expressed by HEK293 , with C-His labeled tag. The total length of GLIPR1 Protein, Mouse (HEK293, His) is 206 a.a., with molecular weight of 27 KDa.

GLIPR1 Protein, a member of the CRISP (cysteine-rich secretory protein) family, is a multifunctional protein involved in various cellular processes. It is primarily known for its role in cancer development and progression. GLIPR1 Protein has been implicated in regulating apoptosis (programmed cell death), cell proliferation, and cell migration. In cancer cells, GLIPR1 Protein can act as both a tumor suppressor or an oncogene, depending on the context. It can induce apoptosis and inhibit tumor growth in certain types of cancer, while promoting tumor cell survival and metastasis in others. Additionally, GLIPR1 Protein has been shown to modulate immune responses and contribute to the regulation of inflammation. Further research is needed to fully elucidate the mechanisms underlying the diverse functions of GLIPR1 Protein and its potential as a therapeutic target in cancer and other diseases.

Mouse

HEK293

C-His

Q9CWG1/NP_082884.1 (S18-T223)

73690  [NCBI]

SSFTASTLPDITNEDFIKECVQVHNQLRSKVSPPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRHVCGHYTQVVWADSYKLGCAVQLCPNGANFICDYGPAGNYPTWPYKQGATCSDCPKDDKCLNSLCINPRRDQVSRYYSVDYPDWPIYLRNRYT

Approximately 27 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.