GLP1R Protein, Mouse (HEK293, His)
GLP1R protein, a G-protein coupled receptor, binds to GLP-1, activating adenylyl cyclase and increasing intracellular cAMP levels. This interaction regulates insulin secretion and maintains glucose homeostasis. GLP1R can also form dimers with GIPR, suggesting complex regulatory mechanisms and interactions with other receptors. GLP1R, Mouse (HEK293, His) is the recombinant mouse-derived GLP1R protein, expressed by HEK293, with labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GLP1R protein, a G-protein coupled receptor, binds to GLP-1, activating adenylyl cyclase and increasing intracellular cAMP levels. This interaction regulates insulin secretion and maintains glucose homeostasis. GLP1R can also form dimers with GIPR, suggesting complex regulatory mechanisms and interactions with other receptors. GLP1R, Mouse (HEK293, His) is the recombinant mouse-derived GLP1R protein, expressed by HEK293, with labeled tag.
Background
GLP1R, a G-protein coupled receptor, specifically binds to glucagon-like peptide 1 (GLP-1), initiating a signaling cascade that activates adenylyl cyclase, leading to elevated intracellular cAMP levels. This molecular interaction plays a pivotal role in the regulation of insulin secretion in response to GLP-1, contributing to glucose homeostasis. Furthermore, GLP1R exhibits the potential to form homodimers and heterodimers with the GIPR receptor, indicating possible complexities in its regulatory mechanisms and interplay with other receptors within the cellular context.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
O35659 (G22-Y145)
-
Gene ID14652
-
Molecular Construction
-
N-term
-
GLP1R (G22-Y145)
Accession # O35659 -
10*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
GLP1R; GLP-1-R; Glucagon Like Peptide 1 Receptor; Seven Transmembrane Helix Receptor; Glucagon-Like Peptide 1 Receptor; GLP1 Receptor; GLP-1R; GLP-1; GLP-1 Receptor
-
AA Sequence
GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
-
Predicted Molecular Mass
15.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
