GNG13 Protein, Human (His)
GNG13 protein, a member of the G protein family, is crucial in diverse transmembrane signaling systems, serving as a modulator or transducer. Its beta and gamma chains within the G protein structure facilitate GTPase activity, enabling GDP-GTP exchange and mediating interactions with effectors. G proteins, with three subunits—alpha, beta, and gamma—work together to regulate and transduce signals across cell membranes. GNG13 Protein, Human (His) is the recombinant human-derived GNG13 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GNG13 protein, a member of the G protein family, is crucial in diverse transmembrane signaling systems, serving as a modulator or transducer. Its beta and gamma chains within the G protein structure facilitate GTPase activity, enabling GDP-GTP exchange and mediating interactions with effectors. G proteins, with three subunits—alpha, beta, and gamma—work together to regulate and transduce signals across cell membranes. GNG13 Protein, Human (His) is the recombinant human-derived GNG13 protein, expressed by E. coli , with N-His labeled tag.
Background
GNG13, a member of the guanine nucleotide-binding protein (G protein) family, functions as a critical component in diverse transmembrane signaling systems, serving either as a modulator or transducer. Within the G protein structure, the beta and gamma chains play essential roles in facilitating GTPase activity, enabling the exchange of GDP for GTP, and mediating interactions between G proteins and their effectors. The fundamental architecture of G proteins consists of three subunits—alpha, beta, and gamma—working in concert to regulate and transduce signals across cell membranes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9P2W3 (M1-C64)
-
Molecular Construction
-
N-term
-
His
-
GNG13 (M1-C64)
Accession # Q9P2W3 -
C-term
-
-
Protein Length
Full Length of Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 Chain
-
Synonyms
GNG13; Guanine Nucleotide Binding Protein (G Protein), Gamma 13; G Protein Subunit Gamma 13; G Gamma Subunit, Clone:H2-35; G(Gamma)13; Heterotrimeric Guanine Nucleotide-Binding Protein 3J; H2-35; Guanine Nucleotide Binding Protein 13, Gamma; Guanine Nucle
-
AA Sequence
MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKC
-
Predicted Molecular Mass
9.7 kDa
-
Molecular Weight
Approximately 9 kDa & 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
