1. Recombinant Proteins
  2. Others
  3. GNG13 Protein, Human (His)

GNG13 protein, a member of the G protein family, is crucial in diverse transmembrane signaling systems, serving as a modulator or transducer. Its beta and gamma chains within the G protein structure facilitate GTPase activity, enabling GDP-GTP exchange and mediating interactions with effectors. G proteins, with three subunits—alpha, beta, and gamma—work together to regulate and transduce signals across cell membranes. GNG13 Protein, Human (His) is the recombinant human-derived GNG13 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GNG13 protein, a member of the G protein family, is crucial in diverse transmembrane signaling systems, serving as a modulator or transducer. Its beta and gamma chains within the G protein structure facilitate GTPase activity, enabling GDP-GTP exchange and mediating interactions with effectors. G proteins, with three subunits—alpha, beta, and gamma—work together to regulate and transduce signals across cell membranes. GNG13 Protein, Human (His) is the recombinant human-derived GNG13 protein, expressed by E. coli , with N-His labeled tag.

Background

GNG13, a member of the guanine nucleotide-binding protein (G protein) family, functions as a critical component in diverse transmembrane signaling systems, serving either as a modulator or transducer. Within the G protein structure, the beta and gamma chains play essential roles in facilitating GTPase activity, enabling the exchange of GDP for GTP, and mediating interactions between G proteins and their effectors. The fundamental architecture of G proteins consists of three subunits—alpha, beta, and gamma—working in concert to regulate and transduce signals across cell membranes.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9P2W3 (M1-C64)

Gene ID
Molecular Construction
N-term
His
GNG13 (M1-C64)
Accession # Q9P2W3
C-term
Protein Length

Partial

Synonyms
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
AA Sequence

MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKC

Predicted Molecular Mass
9.7 kDa
Molecular Weight

Approximately 9 kDa & 18 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GNG13 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GNG13 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GNG13 Protein, Human (His)
Cat. No.:
HY-P76368
Quantity:
MCE Japan Authorized Agent: