1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Granzyme H/GZMH Protein, Human (HEK293, His)

The Granzyme H/GZMH protein, encoded by this gene, belongs to the peptidase S1 family. It is expressed in NK cells and plays a role in the cytotoxic arm of the innate immune response. It induces target cell death and cleaves substrates in infected cells. It is located on chromosome 14 and is broadly expressed, including in the spleen, bone marrow, and 21 other tissues. Granzyme H/GZMH Protein, Human (HEK293, His) is the recombinant human-derived Granzyme H/GZMH, expressed by HEK293, with C-His labeled tag. The total length of Granzyme H/GZMH Protein, Human (HEK293, His) is 228 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Granzyme H/GZMH protein, encoded by this gene, belongs to the peptidase S1 family. It is expressed in NK cells and plays a role in the cytotoxic arm of the innate immune response. It induces target cell death and cleaves substrates in infected cells. It is located on chromosome 14 and is broadly expressed, including in the spleen, bone marrow, and 21 other tissues. Granzyme H/GZMH Protein, Human (HEK293, His) is the recombinant human-derived Granzyme H/GZMH, expressed by HEK293, with C-His labeled tag. The total length of Granzyme H/GZMH Protein, Human (HEK293, His) is 228 a.a..

Background

The Granzyme H/GZMH protein, a member of the peptidase S1 family of serine proteases, is encoded by this gene. Through alternative splicing, multiple transcript variants are produced, with at least one encoding a preproprotein that undergoes proteolytic processing to generate a chymotrypsin-like protease. Constitutively expressed in NK (natural killer) cells of the immune system, this protein is believed to have a role in the innate immune response's cytotoxic arm. It induces target cell death and directly cleaves substrates in pathogen-infected cells. This gene is located in a gene cluster on chromosome 14, alongside another member of the granzyme subfamily. The Granzyme H/GZMH protein exhibits broad expression, with notable levels found in tissues such as the spleen, bone marrow, and 21 other tissues.

Biological Activity

Measured by its ability to cleave a peptide substrate, 100 µM Suc-FLF-SBzl, in the presence of 5,5’-Dithio-bis (2-nitrobenzoic acid) (DTNB). that incubate at room temperaturein kinetic mode for 5 minutes.The specific activity is >5,000 pmol/min/µg. (Activation description: The proenzyme needs to be activated by Mouse Cathepsin C (HY-P704018) for an activated form.)

Species

Human

Source

HEK293

Tag

C-6*His

Accession

NP_219491.1 (E19-L246)

Gene ID
Molecular Construction
N-term
GZMH (E19-L246)
Accession # NP_219491.1
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Granzyme H; CCP-X; CTSGL2; CSP-C; GZMH; CGL2
AA Sequence

EEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL

Molecular Weight

Approximately 35-40 kDa band in SDS-PAGE under reducing conditions due to the glycosylation.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, pH 8.0, 0.1% Brij-35.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Granzyme H/GZMH Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Granzyme H/GZMH Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Granzyme H/GZMH Protein, Human (HEK293, His)
Cat. No.:
HY-P74115
Quantity:
MCE Japan Authorized Agent: