GRO-beta/CXCL2 Protein, Human (HEK293, hFc)
GRO-beta/CXCL2 Protein, generated by activated monocytes and neutrophils, is prominently expressed at inflammatory sites. Notably, this chemokine, with hematoregulatory properties, suppresses hematopoietic progenitor cell proliferation in vitro. GRO-beta(5-73) displays heightened hematopoietic activity, emphasizing its significant role in regulating hematopoiesis. GRO-beta/CXCL2 Protein, Human (HEK293, hFc) is the recombinant human-derived GRO-beta/CXCL2 protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GRO-beta/CXCL2 Protein, generated by activated monocytes and neutrophils, is prominently expressed at inflammatory sites. Notably, this chemokine, with hematoregulatory properties, suppresses hematopoietic progenitor cell proliferation in vitro. GRO-beta(5-73) displays heightened hematopoietic activity, emphasizing its significant role in regulating hematopoiesis. GRO-beta/CXCL2 Protein, Human (HEK293, hFc) is the recombinant human-derived GRO-beta/CXCL2 protein, expressed by HEK293, with C-hFc labeled tag.
Background
GRO-beta/CXCL2, generated by activated monocytes and neutrophils, is prominently expressed at sites of inflammation. This chemokine exhibits hematoregulatory properties, as it has been observed to suppress the proliferation of hematopoietic progenitor cells in vitro. Particularly noteworthy is the heightened hematopoietic activity displayed by GRO-beta(5-73), emphasizing its significant role in regulating hematopoiesis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P19875 (A35-N107)
-
Gene ID2920
-
Molecular Construction
-
N-term
-
CXCL2 (A35-N107)
Accession # P19875 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL2; Growth-Regulated Protein Beta; Prev. GRO2; GRO2 Oncogene; SCYB2; MIP2-Alpha; CINC-2a; Gro-Beta; MGSA-B; MIP2A; MIP-2a; Melanoma Growth Stimulatory Activity Beta; GROb; MGSA Beta; Macrophage Inflammatory Protein 2-Alpha; MIP2; Chemokine (C-X-C Motif
-
AA Sequence
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
-
Predicted Molecular Mass
34.3 kDa
-
Molecular Weight
Approximately 38-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
