1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. MIP-2/GRO-beta
  6. GRO-beta/CXCL2 Protein, Human (HEK293, hFc)

GRO-beta/CXCL2 Protein, generated by activated monocytes and neutrophils, is prominently expressed at inflammatory sites. Notably, this chemokine, with hematoregulatory properties, suppresses hematopoietic progenitor cell proliferation in vitro. GRO-beta(5-73) displays heightened hematopoietic activity, emphasizing its significant role in regulating hematopoiesis. GRO-beta/CXCL2 Protein, Human (HEK293, hFc) is the recombinant human-derived GRO-beta/CXCL2 protein, expressed by HEK293, with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GRO-beta/CXCL2 Protein, generated by activated monocytes and neutrophils, is prominently expressed at inflammatory sites. Notably, this chemokine, with hematoregulatory properties, suppresses hematopoietic progenitor cell proliferation in vitro. GRO-beta(5-73) displays heightened hematopoietic activity, emphasizing its significant role in regulating hematopoiesis. GRO-beta/CXCL2 Protein, Human (HEK293, hFc) is the recombinant human-derived GRO-beta/CXCL2 protein, expressed by HEK293, with C-hFc labeled tag.

Background

GRO-beta/CXCL2, generated by activated monocytes and neutrophils, is prominently expressed at sites of inflammation. This chemokine exhibits hematoregulatory properties, as it has been observed to suppress the proliferation of hematopoietic progenitor cells in vitro. Particularly noteworthy is the heightened hematopoietic activity displayed by GRO-beta(5-73), emphasizing its significant role in regulating hematopoiesis.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P19875 (A35-N107)

Gene ID

2920

Molecular Construction
N-term
CXCL2 (A35-N107)
Accession # P19875
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
GRO-β/CXCL2; C-X-C motif chemokine 2; MIP2-alpha; HSF
AA Sequence

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Predicted Molecular Mass
34.3 kDa
Molecular Weight

Approximately 38-42 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GRO-beta/CXCL2 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GRO-beta/CXCL2 Protein, Human (HEK293, hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GRO-beta/CXCL2 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P704371
Quantity:
MCE Japan Authorized Agent: