GSTP1 Protein, Human (His, solution)

The GSTP1 protein is critical for binding reduced glutathione to a variety of hydrophobic electrophiles, actively forming glutathione conjugates of PGA2 and PGJ2. Documented studies highlight its involvement in hepoxilin regioisomer synthesis, emphasizing the versatility of GSTP1 in processing substrates. GSTP1 Protein, Human (His) is the recombinant human-derived GSTP1 protein, expressed by E. coli , with N-10*His labeled tag.

The GSTP1 protein plays a crucial role in the cellular process of conjugating reduced glutathione to a diverse range of exogenous and endogenous hydrophobic electrophiles. Specifically, GSTP1 is actively involved in the formation of glutathione conjugates for prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2), as documented in studies. Furthermore, GSTP1 participates in the synthesis of novel hepoxilin regioisomers, underscoring its versatility in handling various substrates. Beyond its role in detoxification, GSTP1 negatively regulates CDK5 activity by facilitating the translocation of p25/p35, serving as a crucial mechanism to prevent neurodegeneration.

Measured by the conjugation of reduced glutathione to 1-bromo-2, 4-dinitrobenzene that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is >20000 pmol/min/μg.

Human

E. coli

N-10*His

P09211 (P2-Q210)

2950

Full Length of Mature Protein

PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Approximately 25-30 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.4, 1 mM DTT, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/hepg2-cell.html  [Content Brief]