HBP1 Protein, Human (His)
Based on 1 Customer Validation
HBP1 is a transcriptional repressor that regulates target genes by binding specifically to promoter regions, specifically favoring the sequence 5'-TTCATTCATTCA-3'.Its key role in the cell cycle and Wnt pathway involves promoting enhanced binding to the histone H1.0 promoter through the RB1 interaction.HBP1 Protein, Human (His) is the recombinant human-derived HBP1 protein, expressed by E.coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
HBP1 is a transcriptional repressor that regulates target genes by binding specifically to promoter regions, specifically favoring the sequence 5'-TTCATTCATTCA-3'.Its key role in the cell cycle and Wnt pathway involves promoting enhanced binding to the histone H1.0 promoter through the RB1 interaction.HBP1 Protein, Human (His) is the recombinant human-derived HBP1 protein, expressed by E.coli , with N-His labeled tag.
Background
HBP1, a transcriptional repressor, exerts its regulatory influence by binding specifically to the promoter region of target genes. It plays a pivotal role in governing both the cell cycle and the Wnt pathway, displaying a preference for the sequence 5'-TTCATTCATTCA-3'. The interaction with RB1 enhances its binding to the histone H1.0 promoter, contributing to its regulatory function. Additionally, HBP1 disrupts the DNA-TCF4 interaction and binds to the second PAH repeat of SIN3A. Notably, it engages in direct interactions with TCF4 and RB1, further underscoring its involvement in intricate regulatory networks.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O60381 (P208-F345)
-
Molecular Construction
-
N-term
-
His
-
HBP1 (P208-F345)
Accession # O60381 -
C-term
-
-
Protein Length
Partial
-
Synonyms
HBP1; HMG Box-Containing Protein 1; HMG-Box Transcription Factor 1; HMG Box Transcription Factor 1; High Mobility Group Box Transcription Factor 1
-
AA Sequence
PSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINF
-
Predicted Molecular Mass
15.3 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)