HBP1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

HBP1 is a transcriptional repressor that regulates target genes by binding specifically to promoter regions, specifically favoring the sequence 5'-TTCATTCATTCA-3'.Its key role in the cell cycle and Wnt pathway involves promoting enhanced binding to the histone H1.0 promoter through the RB1 interaction.HBP1 Protein, Human (His) is the recombinant human-derived HBP1 protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

HBP1 is a transcriptional repressor that regulates target genes by binding specifically to promoter regions, specifically favoring the sequence 5'-TTCATTCATTCA-3'.Its key role in the cell cycle and Wnt pathway involves promoting enhanced binding to the histone H1.0 promoter through the RB1 interaction.HBP1 Protein, Human (His) is the recombinant human-derived HBP1 protein, expressed by E.coli , with N-His labeled tag.

Background

HBP1, a transcriptional repressor, exerts its regulatory influence by binding specifically to the promoter region of target genes. It plays a pivotal role in governing both the cell cycle and the Wnt pathway, displaying a preference for the sequence 5'-TTCATTCATTCA-3'. The interaction with RB1 enhances its binding to the histone H1.0 promoter, contributing to its regulatory function. Additionally, HBP1 disrupts the DNA-TCF4 interaction and binds to the second PAH repeat of SIN3A. Notably, it engages in direct interactions with TCF4 and RB1, further underscoring its involvement in intricate regulatory networks.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • HBP1 (P208-F345)
      Accession # O60381
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HBP1; HMG Box-Containing Protein 1; HMG-Box Transcription Factor 1; HMG Box Transcription Factor 1; High Mobility Group Box Transcription Factor 1

  • AA Sequence

    PSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINF

  • Predicted Molecular Mass

    15.3 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00