gp36 Protein, HIV-2 (His-MBP)
gp36 Protein is a transmembrane protein of HIV-2.gp36 Protein can bind to human T lymphocytes, B lymphocytes and monocytes.gp36 Protein, HIV-2 (His-MBP) is the recombinant Virus-derived gp36 protein, expressed by E.coli , with N-His, N-MBP labeled tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
gp36 Protein is a transmembrane protein of HIV-2.gp36 Protein can bind to human T lymphocytes, B lymphocytes and monocytes.gp36 Protein, HIV-2 (His-MBP) is the recombinant Virus-derived gp36 protein, expressed by E.coli , with N-His, N-MBP labeled tag.
Background
gp36 Protein is a transmembrane protein of HIV-2. gp36 Protein can bind to human T lymphocytes, B lymphocytes and monocytes. The gp36 Protein binds to the putative cell receptor proteins P45 and P62[1]
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag N-His;N-MBP
-
Accession
BAM76170 (Q547-Y670)
-
Gene ID/
-
Molecular Construction
-
N-term
-
His-MBP
-
gp36 (Q547-Y670)
Accession # BAM76170 -
C-term
-
-
Protein Length
Partial
-
Synonyms
GP36; HIV-2 gp36 Protein (subtype CRF01_AB, strain 07JP_NMC716_clone_01)
-
AA Sequence
QLLDVVKRQQEMLRLTVWGTKNLQARVTAIEKYLKDQAQLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQQWEKQIRYLEANISISLEQAQIQQEKNMYELQKLNSWDVFGNWFDLTSWIKY
-
Predicted Molecular Mass
58.8 kDa
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
