gp36 Protein, HIV-2 (His-MBP)

gp36 Protein is a transmembrane protein of HIV-2.gp36 Protein can bind to human T lymphocytes, B lymphocytes and monocytes.gp36 Protein, HIV-2 (His-MBP) is the recombinant Virus-derived gp36 protein, expressed by E.coli , with N-His, N-MBP labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

gp36 Protein is a transmembrane protein of HIV-2.gp36 Protein can bind to human T lymphocytes, B lymphocytes and monocytes.gp36 Protein, HIV-2 (His-MBP) is the recombinant Virus-derived gp36 protein, expressed by E.coli , with N-His, N-MBP labeled tag.

Background

gp36 Protein is a transmembrane protein of HIV-2. gp36 Protein can bind to human T lymphocytes, B lymphocytes and monocytes. The gp36 Protein binds to the putative cell receptor proteins P45 and P62[1]

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag N-His;N-MBP
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-MBP
    • gp36 (Q547-Y670)
      Accession # BAM76170
    • C-term
  • Protein Length

    Partial

  • Synonyms

    GP36; HIV-2 gp36 Protein (subtype CRF01_AB, strain 07JP_NMC716_clone_01)

  • AA Sequence

    QLLDVVKRQQEMLRLTVWGTKNLQARVTAIEKYLKDQAQLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQQWEKQIRYLEANISISLEQAQIQQEKNMYELQKLNSWDVFGNWFDLTSWIKY

  • Predicted Molecular Mass

    58.8 kDa

  • Molecular Weight

    Approximately 55 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00