1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. HS3ST1 Protein, Human (sf9, His)

The HS3ST1 protein utilizes PAPS to crucially catalyze the transfer of sulfate to position 3 of the glucosamine residue in heparan sulfate (HS), representing the rate-limiting step in HS biosynthesis. This activity is essential for the formation of the anticoagulant heparan sulfate and completion of the antithrombin pentasaccharide binding site. HS3ST1 Protein, Human (sf9, His) is the recombinant human-derived HS3ST1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HS3ST1 protein utilizes PAPS to crucially catalyze the transfer of sulfate to position 3 of the glucosamine residue in heparan sulfate (HS), representing the rate-limiting step in HS biosynthesis. This activity is essential for the formation of the anticoagulant heparan sulfate and completion of the antithrombin pentasaccharide binding site. HS3ST1 Protein, Human (sf9, His) is the recombinant human-derived HS3ST1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

HS3ST1 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as its substrate, plays a pivotal role in the biosynthesis of heparan sulfate (HS) by catalyzing the transfer of a sulfo group to position 3 of glucosamine residues in heparan. This enzymatic activity represents the rate-limiting step in HS biosynthesis, crucial for the formation of anticoagulant heparan sulfate. The sulfation at position 3 of glucosamine residues, facilitated by HS3ST1, is particularly significant as it completes the structure of the antithrombin pentasaccharide binding site. By modulating heparan sulfate biosynthesis, HS3ST1 contributes to the generation of structurally specific molecules involved in anticoagulation, emphasizing its crucial role in regulating blood coagulation processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

O14792 (R21-H307)

Gene ID
Molecular Construction
N-term
His
HS3ST1 (R21-H307)
Accession # O14792
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Heparan sulfate glucosamine 3-O-sulfotransferase 1; 3-OST-1; 3OST; 3OST1
AA Sequence

RPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH

Molecular Weight

Approximately 36 kDa.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% Glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

HS3ST1 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HS3ST1 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HS3ST1 Protein, Human (sf9, His)
Cat. No.:
HY-P76974
Quantity:
MCE Japan Authorized Agent: