Copy Link Print Information

HS3ST1 Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

The HS3ST1 protein utilizes PAPS to crucially catalyze the transfer of sulfate to position 3 of the glucosamine residue in heparan sulfate (HS), representing the rate-limiting step in HS biosynthesis. This activity is essential for the formation of the anticoagulant heparan sulfate and completion of the antithrombin pentasaccharide binding site. HS3ST1 Protein, Human (sf9, His) is the recombinant human-derived HS3ST1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • HS3ST1 Protein, Human (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The HS3ST1 protein utilizes PAPS to crucially catalyze the transfer of sulfate to position 3 of the glucosamine residue in heparan sulfate (HS), representing the rate-limiting step in HS biosynthesis. This activity is essential for the formation of the anticoagulant heparan sulfate and completion of the antithrombin pentasaccharide binding site. HS3ST1 Protein, Human (sf9, His) is the recombinant human-derived HS3ST1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

HS3ST1 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as its substrate, plays a pivotal role in the biosynthesis of heparan sulfate (HS) by catalyzing the transfer of a sulfo group to position 3 of glucosamine residues in heparan. This enzymatic activity represents the rate-limiting step in HS biosynthesis, crucial for the formation of anticoagulant heparan sulfate. The sulfation at position 3 of glucosamine residues, facilitated by HS3ST1, is particularly significant as it completes the structure of the antithrombin pentasaccharide binding site. By modulating heparan sulfate biosynthesis, HS3ST1 contributes to the generation of structurally specific molecules involved in anticoagulation, emphasizing its crucial role in regulating blood coagulation processes.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His
  • Accession

    O14792 (R21-H307)

  • Gene ID
    9957  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • HS3ST1 (R21-H307)
      Accession # O14792
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    HS3ST1; Heparan Sulfate 3-O-Sulfotransferase 1; Heparan Sulfate-Glucosamine 3-Sulfotransferase 1; H3-OST-1; 3OST1; 3-OST-1; Heparan Sulfate D-Glucosaminyl 3-O-Sulfotransferase 1; 3OST; Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 1; Heparin-Glucosam

  • AA Sequence

    RPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH

  • Predicted Molecular Mass

    36 kDa

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% Glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • HS3ST1 Protein, Human (sf9, His) Product Image
    1/16
  • HS3ST1 Protein, Human (sf9, His) Product Image