HSD17B10 Protein, Human (sf9, GST)

HSD17B10 Protein, Human (sf9, GST) is the recombinant human-derived HSD17B10, expressed by Sf9 insect cells , with GST labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

HSD17B10 Protein, Human (sf9, GST) is the recombinant human-derived HSD17B10, expressed by Sf9 insect cells , with GST labeled tag. ,

Background

ERAB is a mitochondrial dehydrogenase involved in pathways of fatty acid, branched-chain amino acid, and steroid metabolism. It acts as (S)-3-hydroxyacyl-CoA dehydrogenase in mitochondrial fatty acid beta-oxidation, catalyzing the reversible conversion of (S)-3-hydroxyacyl-CoA to 3-ketoacyl-CoA, with a preference for straight medium- and short-chain acyl-CoA substrates, most efficiently for (3S)-hydroxybutanoyl-CoA. In branched-chain amino acid catabolism, it functions as 3-hydroxy-2-methylbutyryl-CoA dehydrogenase, oxidizing 3-hydroxy-2-methylbutanoyl-CoA in the isoleucine degradation pathway. It also exhibits hydroxysteroid dehydrogenase activity toward steroid hormones and bile acids, oxidizing 3alpha-, 17beta-, 20beta-, and 21-hydroxysteroids as well as 7alpha- and 7beta-hydroxy bile acids. Additionally, ERAB has phospholipase C-like activity toward cardiolipin and its oxidized species, potentially degrading these during oxidative stress to protect cells from apoptosis. Interaction with intracellular amyloid-beta may contribute to neuronal dysfunction in Alzheimer's disease. ERAB is essential for mitochondrial structural and functional integrity. by similar: ERAB also moonlights as a component of mitochondrial ribonuclease P, which cleaves tRNA at the 5'-end. It forms the MRPP1-MRPP2 subcomplex with TRMT10C/MRPP1, catalyzing the formation of N(1)-methylguanine and N(1)-methyladenine at position 9 in tRNAs and serving as a tRNA maturation platform to enhance 3'-processing by ELAC2.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    HSD17B10; 7-Alpha-Hydroxysteroid Dehydrogenase; Prev. HADH2; AB-Binding Alcohol Dehydrogenase; Prev. MRXS10; Mitochondrial RNase P Subunit 2; SDR5C1; Type II HADH; MRPP2; SCHAD; ERAB; Hydroxyacyl-Coenzyme A Dehydrogenase, Type II, Hydroxyacyl-Coenzyme A D

  • AA Sequence

    MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

  • Molecular Weight

    Approximately 51 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00