1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. HSD17B10 Protein, Human (sf9, GST)

HSD17B10 Protein, Human (sf9, GST) is the recombinant human-derived HSD17B10, expressed by Sf9 insect cells , with GST labeled tag. ,

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
20 μg 견적 받기
100 μg 견적 받기

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

HSD17B10 Protein, Human (sf9, GST) is the recombinant human-derived HSD17B10, expressed by Sf9 insect cells , with GST labeled tag. ,

Background

ERAB is a mitochondrial dehydrogenase involved in pathways of fatty acid, branched-chain amino acid, and steroid metabolism. It acts as (S)-3-hydroxyacyl-CoA dehydrogenase in mitochondrial fatty acid beta-oxidation, catalyzing the reversible conversion of (S)-3-hydroxyacyl-CoA to 3-ketoacyl-CoA, with a preference for straight medium- and short-chain acyl-CoA substrates, most efficiently for (3S)-hydroxybutanoyl-CoA. In branched-chain amino acid catabolism, it functions as 3-hydroxy-2-methylbutyryl-CoA dehydrogenase, oxidizing 3-hydroxy-2-methylbutanoyl-CoA in the isoleucine degradation pathway. It also exhibits hydroxysteroid dehydrogenase activity toward steroid hormones and bile acids, oxidizing 3alpha-, 17beta-, 20beta-, and 21-hydroxysteroids as well as 7alpha- and 7beta-hydroxy bile acids. Additionally, ERAB has phospholipase C-like activity toward cardiolipin and its oxidized species, potentially degrading these during oxidative stress to protect cells from apoptosis. Interaction with intracellular amyloid-beta may contribute to neuronal dysfunction in Alzheimer's disease. ERAB is essential for mitochondrial structural and functional integrity. by similar: ERAB also moonlights as a component of mitochondrial ribonuclease P, which cleaves tRNA at the 5'-end. It forms the MRPP1-MRPP2 subcomplex with TRMT10C/MRPP1, catalyzing the formation of N(1)-methylguanine and N(1)-methyladenine at position 9 in tRNAs and serving as a tRNA maturation platform to enhance 3'-processing by ELAC2.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

Q99714-1 (M1-P261)

Gene ID

3028

Protein Length

Full Length of Isoform-1

Synonyms
ERAB; HADH2; MRPP2; SCHAD; SDR5C1; XH98G2
AA Sequence

MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Predicted Molecular Mass
51 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

각종 서류

HSD17B10 Protein, Human (sf9, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

HSD17B10 Protein, Human (sf9, GST)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
HSD17B10 Protein, Human (sf9, GST)
Cat. No.:
HY-P702965
수량:
MCE Japan Authorized Agent: