I-309/CCL1 Protein, Human (HEK293)
I-309/CCL1 Protein, Human (HEK293) is the recombinant human-derived I-309/CCL1 protein, expressed by HEK293, with tag free tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
I-309/CCL1 Protein, Human (HEK293) is the recombinant human-derived I-309/CCL1 protein, expressed by HEK293, with tag free tag.
Background
I-309/CCL1 is a cytokine that exhibits chemotactic activity for monocytes but not for neutrophils. It functions by binding to the CCR8 receptor.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P22362 (K24-K96)
-
Gene ID6346
-
Molecular Construction
-
N-term
-
CCL1 (K24-K96)
Accession # P22362 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL1; SISe; Prev. SCYA1; Chemokine (C-C Motif) Ligand 1; T Lymphocyte-Secreted Protein I-309; Inflammatory Cytokine I-309; I-309; C-C Motif Chemokine 1; TCA3; Small-Inducible Cytokine A1; P500; C-C Motif Chemokine Ligand 1; Small Inducible Cytokine A1 (I-
-
AA Sequence
KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
-
Predicted Molecular Mass
9.2 kDa
-
Molecular Weight
Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
