ICA Protein, Mouse (HEK293, His)

ICA Protein, a potent inhibitor of carbonic anhydrase 2 (CA2), intricately regulates enzymatic activity within a finely tuned network. Functionally, ICA, a non-iron-binding monomer, exhibits specificity in inhibiting CA2. Its transferrin-like domain 2 engages in molecular interactions, underscoring ICA's regulatory role. This positions ICA as a key player, adding nuance to the precise mechanisms governing carbonic anhydrase activity. ICA Protein, Mouse (HEK293, His) is the recombinant mouse-derived ICA protein, expressed by HEK293 , with C-His labeled tag.

ICA protein emerges as a potent inhibitor for carbonic anhydrase 2 (CA2), contributing to the intricate regulatory network governing carbonic anhydrase activity. In its functional role, ICA does not bind iron ions, delineating its specificity in enzymatic inhibition. Structurally, ICA functions as a monomer, underscoring its individuality in executing its inhibitory function. Notably, ICA engages in molecular interactions, specifically with CA2, through its transferrin-like domain 2, further emphasizing its regulatory role within the context of carbonic anhydrase function. This interplay positions ICA as a key player in modulating carbonic anhydrase activity, adding nuance to the finely tuned mechanisms governing enzymatic processes.

Mouse

HEK293

C-His

Q9DBD0/NP_082194.1 (L20-Y700)

71775  [NCBI]

Full Length of Mature Protein

LPEKTIRWCVVSDHEATKCSSFRDNMKKVLPAGGPAVTCVRKMSHPECIRDISANKVDAVTVDGALVAEADLPHHSLKPIMAEYYGSKDDPKTHYYVVAMAKKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETAAATFFSSSCVPCADGKMFPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVSFVKHLTVFEAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDSIQELLRVAQEHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLRVPRKIDISLYLGYEFLSAFRNLKRGLEDSQRVKWCAVGQQERTKCDQWSAVSGGALACATEETPEDCIAATMKGEADAMSLDGGFAYVAGHCGLVPVLAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVGITWKSLQGKKSCHTAVGTSEGWNVPMGLIYNQTGSCKFDAFFSRSCAPGSDPDSPLCALCVGGNNPAHMCAANNAEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGLKHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRRILFNQQELFGRNGFEYMMFQMFESSAKDLLFSDDTECLSNLQNKTTYKTYLGPQYLTLMDNFRQCLSSELLDACTFHKY

Approximately 76.2-80 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.