1. Recombinant Proteins
  2. Others
  3. ICA Protein, Mouse (HEK293, His)

ICA Protein, a potent inhibitor of carbonic anhydrase 2 (CA2), intricately regulates enzymatic activity within a finely tuned network. Functionally, ICA, a non-iron-binding monomer, exhibits specificity in inhibiting CA2. Its transferrin-like domain 2 engages in molecular interactions, underscoring ICA's regulatory role. This positions ICA as a key player, adding nuance to the precise mechanisms governing carbonic anhydrase activity. ICA Protein, Mouse (HEK293, His) is the recombinant mouse-derived ICA protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ICA Protein, a potent inhibitor of carbonic anhydrase 2 (CA2), intricately regulates enzymatic activity within a finely tuned network. Functionally, ICA, a non-iron-binding monomer, exhibits specificity in inhibiting CA2. Its transferrin-like domain 2 engages in molecular interactions, underscoring ICA's regulatory role. This positions ICA as a key player, adding nuance to the precise mechanisms governing carbonic anhydrase activity. ICA Protein, Mouse (HEK293, His) is the recombinant mouse-derived ICA protein, expressed by HEK293 , with C-His labeled tag.

Background

ICA protein emerges as a potent inhibitor for carbonic anhydrase 2 (CA2), contributing to the intricate regulatory network governing carbonic anhydrase activity. In its functional role, ICA does not bind iron ions, delineating its specificity in enzymatic inhibition. Structurally, ICA functions as a monomer, underscoring its individuality in executing its inhibitory function. Notably, ICA engages in molecular interactions, specifically with CA2, through its transferrin-like domain 2, further emphasizing its regulatory role within the context of carbonic anhydrase function. This interplay positions ICA as a key player in modulating carbonic anhydrase activity, adding nuance to the finely tuned mechanisms governing enzymatic processes.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9DBD0/NP_082194.1 (L20-Y700)

Gene ID
Molecular Construction
N-term
ICA (L20-Y700)
Accession # Q9DBD0/NP_082194.1
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Inhibitor of carbonic anhydrase; Ica
AA Sequence

LPEKTIRWCVVSDHEATKCSSFRDNMKKVLPAGGPAVTCVRKMSHPECIRDISANKVDAVTVDGALVAEADLPHHSLKPIMAEYYGSKDDPKTHYYVVAMAKKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETAAATFFSSSCVPCADGKMFPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVSFVKHLTVFEAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDSIQELLRVAQEHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLRVPRKIDISLYLGYEFLSAFRNLKRGLEDSQRVKWCAVGQQERTKCDQWSAVSGGALACATEETPEDCIAATMKGEADAMSLDGGFAYVAGHCGLVPVLAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVGITWKSLQGKKSCHTAVGTSEGWNVPMGLIYNQTGSCKFDAFFSRSCAPGSDPDSPLCALCVGGNNPAHMCAANNAEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGLKHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRRILFNQQELFGRNGFEYMMFQMFESSAKDLLFSDDTECLSNLQNKTTYKTYLGPQYLTLMDNFRQCLSSELLDACTFHKY

Molecular Weight

Approximately 80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ICA Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ICA Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICA Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73912
Quantity:
MCE Japan Authorized Agent: