IFI30 Protein, Human (HEK293, His)
Based on 1 Customer Validation
IFI30 is a lysosomal thiol reductase that plays a critical role in reducing protein disulfide bonds in the lysosomal environment. This enzymatic activity is critical for complete unfolding of proteins for lysosomal degradation. IFI30 Protein, Human (HEK293, His) is the recombinant human-derived IFI30 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IFI30 is a lysosomal thiol reductase that plays a critical role in reducing protein disulfide bonds in the lysosomal environment. This enzymatic activity is critical for complete unfolding of proteins for lysosomal degradation. IFI30 Protein, Human (HEK293, His) is the recombinant human-derived IFI30 protein, expressed by HEK293 , with C-His labeled tag.
Background
IFI30, a lysosomal thiol reductase, serves as a key player in the reduction of protein disulfide bonds within the lysosomal environment. This enzymatic activity is crucial for the complete unfolding of proteins targeted for lysosomal degradation. Notably, IFI30 plays a pivotal role in antigen processing, specifically contributing to the generation of MHC class II-restricted epitopes from antigens containing disulfide bonds through endocytic reduction. Additionally, IFI30 is implicated in facilitating MHC class I-restricted recognition of exogenous antigens with disulfide bonds by CD8+ T-cells, thus contributing to cross-presentation processes.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P13284 (S27-K232)
-
Molecular Construction
-
N-term
-
IFI30 (S27-K232)
Accession # P13284 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IFI30; IP-30; IFI30 Lysosomal Thiol Reductase; Interferon Gamma-Inducible Protein 30 Preproprotein; Gamma-Interferon-Inducible Lysosomal Thiol Reductase; MGC32056; GILT; Interferon, Gamma-Inducible Protein 30; IP30; Interferon Gamma Inducible Protein 30;
-
AA Sequence
SPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK
-
Molecular Weight
Approximately 31-34 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
