1. Recombinant Proteins
  2. Fc Receptors
  3. Immunoglobulin Fc Region
  4. IgE
  5. IgE Protein, Mouse (HEK293, His-Avi)

IgE is an important component of the immunoglobulin chain that coordinates humoral immunity. As a receptor, membrane-bound IgE initiates clonal expansion and B cell differentiation. IgE Protein, Mouse (HEK293, His-Avi) is the recombinant mouse-derived IgE protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IgE is an important component of the immunoglobulin chain that coordinates humoral immunity. As a receptor, membrane-bound IgE initiates clonal expansion and B cell differentiation. IgE Protein, Mouse (HEK293, His-Avi) is the recombinant mouse-derived IgE protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

IgE, a crucial component of immunoglobulin heavy chains, plays a pivotal role in the intricate orchestration of humoral immunity. Serving as receptors during the recognition phase, membrane-bound immunoglobulins initiate clonal expansion and B lymphocyte differentiation into plasma cells upon antigen binding. In the effector phase, secreted immunoglobulins facilitate the elimination of bound antigens. The antigen-binding site, marked by remarkable affinity for specific antigens, results from the collaboration between the variable domains of one heavy chain and its associated light chain. Through V-(D)-J rearrangement and subsequent somatic hypermutations, the variable domains undergo affinity maturation, enhancing specificity for particular antigens. Structurally, each immunoglobulin consists of two identical heavy chains and two identical light chains, disulfide-linked. The N-terminal variable regions of the heavy and light chains constitute the antigen-binding sites, while the C-terminal constant regions of the heavy chains interact with immune receptors, driving effector functions. This dynamic interplay defines the versatile and precise role of IgE in orchestrating humoral immune responses.

Species

Mouse

Source

HEK293

Tag

C-Avi;C-8*His

Accession

P06336 (D198-S421)

Gene ID
Molecular Construction
N-term
IgE (D198-S421)
Accession # P06336
8*His-Avi
C-term
Protein Length

Partial

Synonyms
Ig epsilon chain C region; IgE
AA Sequence

DHEPRGVITYLIPPSPLDLYQNGAPKLTCLVVDLESEKNVNVTWNQEKKTSVSASQWYTKHHNNATTSITSILPVVAKDWIEGYGYQCIVDHPDFPKPIVRSITKTPGQRSAPEVYVFPPPEEESEDKRTLTCLIQNFFPEDISVQWLGDGKLISNSQHSTTTPLKSNGSNQGFFIFSRLEVAKTLWTQRKQFTCQVIHEALQKPRKLEKTISTSLGNTSLRPS

Predicted Molecular Mass
28.2 kDa
Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IgE Protein, Mouse (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IgE Protein, Mouse (HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IgE Protein, Mouse (HEK293, His-Avi)
Cat. No.:
HY-P77696
Quantity:
MCE Japan Authorized Agent: