IgE Protein, Mouse (HEK293, His-Avi)
Based on 1 Customer Validation
IgE is an important component of the immunoglobulin chain that coordinates humoral immunity. As a receptor, membrane-bound IgE initiates clonal expansion and B cell differentiation. IgE Protein, Mouse (HEK293, His-Avi) is the recombinant mouse-derived IgE protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
IgE is an important component of the immunoglobulin chain that coordinates humoral immunity. As a receptor, membrane-bound IgE initiates clonal expansion and B cell differentiation. IgE Protein, Mouse (HEK293, His-Avi) is the recombinant mouse-derived IgE protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
IgE, a crucial component of immunoglobulin heavy chains, plays a pivotal role in the intricate orchestration of humoral immunity. Serving as receptors during the recognition phase, membrane-bound immunoglobulins initiate clonal expansion and B lymphocyte differentiation into plasma cells upon antigen binding. In the effector phase, secreted immunoglobulins facilitate the elimination of bound antigens. The antigen-binding site, marked by remarkable affinity for specific antigens, results from the collaboration between the variable domains of one heavy chain and its associated light chain. Through V-(D)-J rearrangement and subsequent somatic hypermutations, the variable domains undergo affinity maturation, enhancing specificity for particular antigens. Structurally, each immunoglobulin consists of two identical heavy chains and two identical light chains, disulfide-linked. The N-terminal variable regions of the heavy and light chains constitute the antigen-binding sites, while the C-terminal constant regions of the heavy chains interact with immune receptors, driving effector functions. This dynamic interplay defines the versatile and precise role of IgE in orchestrating humoral immune responses.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P06336 (D198-S421)
-
Molecular Construction
-
N-term
-
IgE (D198-S421)
Accession # P06336 -
8*His-Avi
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IGHE; Ig Epsilon Chain C Region; Immunoglobulin Heavy Constant Epsilon; Immunoglobulin Epsilon; Constant Region Of Heavy Chain Of IgE; IgE; Ig Epsilon Chain C Region ND
-
AA Sequence
DHEPRGVITYLIPPSPLDLYQNGAPKLTCLVVDLESEKNVNVTWNQEKKTSVSASQWYTKHHNNATTSITSILPVVAKDWIEGYGYQCIVDHPDFPKPIVRSITKTPGQRSAPEVYVFPPPEEESEDKRTLTCLIQNFFPEDISVQWLGDGKLISNSQHSTTTPLKSNGSNQGFFIFSRLEVAKTLWTQRKQFTCQVIHEALQKPRKLEKTISTSLGNTSLRPS
-
Predicted Molecular Mass
28.2 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)