IGF1R/IGF-I R Protein, Human (His)

Customer Review

Based on 1 Customer Validation

IGF-I receptor (IGF1R) mediates insulin-like growth factor effects, binding strongly to IGF1. Activation triggers PI3K-AKT/PKB and Ras-MAPK pathways, influencing cell survival, protein synthesis, and proliferation. IGF1R also signals through JAK/STAT, inhibiting JNK activation. Hybrid receptors show variable binding to IGF1 and insulin. IGF1R/IGF-I R Protein, Human (His) is the recombinant human-derived IGF1R/IGF-I R Protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IGF-I receptor (IGF1R) mediates insulin-like growth factor effects, binding strongly to IGF1. Activation triggers PI3K-AKT/PKB and Ras-MAPK pathways, influencing cell survival, protein synthesis, and proliferation. IGF1R also signals through JAK/STAT, inhibiting JNK activation. Hybrid receptors show variable binding to IGF1 and insulin. IGF1R/IGF-I R Protein, Human (His) is the recombinant human-derived IGF1R/IGF-I R Protein, expressed by E. coli , with N-6*His labeled tag.

Background

The IGF-I receptor (IGF1R) is a receptor tyrosine kinase that plays a pivotal role in mediating the actions of insulin-like growth factor 1 (IGF1). It exhibits high affinity for IGF1 and lower affinity for IGF2 and insulin (INS). Upon ligand binding, IGF1R activates its kinase, leading to receptor autophosphorylation and tyrosine phosphorylation of various substrates, including insulin-receptor substrates (IRS1/2), Shc, and 14-3-3 proteins. This initiates two main signaling pathways: the PI3K-AKT/PKB pathway, which inhibits apoptosis and stimulates protein synthesis, and the Ras-MAPK pathway, promoting increased cellular proliferation. Phosphorylated IRS1 can activate the PI3K pathway, leading to downstream activation of AKT/PKB and subsequent enhancement of protein synthesis and antiapoptotic effects. Simultaneously, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc activates the Ras-MAPK pathway. Additionally, IGF1R signals through the JAK/STAT pathway, potentially contributing to its transforming activity. The JNK kinases can also be activated by IGF1R, and IGF1 inhibits JNK activation by phosphorylating and inhibiting MAP3K5/ASK1. Hybrid receptors composed of IGF1R and INSR isoforms exhibit varying binding characteristics, indicating high affinity for IGF1 and low affinity for insulin.

Verified Bioactivity

This product does not contain protein kinase domain.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • IGF-I R (Y763-E931)
      Accession # P08069
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    IGF1R; IGF-I Receptor; Insulin Like Growth Factor 1 Receptor; MGC18216; Insulin-Like Growth Factor 1 Receptor; Insulin-Like Growth Factor I Receptor; JTK13; Receptor Protein-Tyrosine Kinase; CD221; Tyrosine-Protein Kinase Receptor; IGFIR; CD221 Antigen; I

  • AA Sequence

    YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

  • Molecular Weight

    Approximately 21-27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00