IGF1R/IGF-I R Protein, Human (His)
Based on 1 Customer Validation
IGF-I receptor (IGF1R) mediates insulin-like growth factor effects, binding strongly to IGF1. Activation triggers PI3K-AKT/PKB and Ras-MAPK pathways, influencing cell survival, protein synthesis, and proliferation. IGF1R also signals through JAK/STAT, inhibiting JNK activation. Hybrid receptors show variable binding to IGF1 and insulin. IGF1R/IGF-I R Protein, Human (His) is the recombinant human-derived IGF1R/IGF-I R Protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IGF-I receptor (IGF1R) mediates insulin-like growth factor effects, binding strongly to IGF1. Activation triggers PI3K-AKT/PKB and Ras-MAPK pathways, influencing cell survival, protein synthesis, and proliferation. IGF1R also signals through JAK/STAT, inhibiting JNK activation. Hybrid receptors show variable binding to IGF1 and insulin. IGF1R/IGF-I R Protein, Human (His) is the recombinant human-derived IGF1R/IGF-I R Protein, expressed by E. coli , with N-6*His labeled tag.
Background
The IGF-I receptor (IGF1R) is a receptor tyrosine kinase that plays a pivotal role in mediating the actions of insulin-like growth factor 1 (IGF1). It exhibits high affinity for IGF1 and lower affinity for IGF2 and insulin (INS). Upon ligand binding, IGF1R activates its kinase, leading to receptor autophosphorylation and tyrosine phosphorylation of various substrates, including insulin-receptor substrates (IRS1/2), Shc, and 14-3-3 proteins. This initiates two main signaling pathways: the PI3K-AKT/PKB pathway, which inhibits apoptosis and stimulates protein synthesis, and the Ras-MAPK pathway, promoting increased cellular proliferation. Phosphorylated IRS1 can activate the PI3K pathway, leading to downstream activation of AKT/PKB and subsequent enhancement of protein synthesis and antiapoptotic effects. Simultaneously, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc activates the Ras-MAPK pathway. Additionally, IGF1R signals through the JAK/STAT pathway, potentially contributing to its transforming activity. The JNK kinases can also be activated by IGF1R, and IGF1 inhibits JNK activation by phosphorylating and inhibiting MAP3K5/ASK1. Hybrid receptors composed of IGF1R and INSR isoforms exhibit varying binding characteristics, indicating high affinity for IGF1 and low affinity for insulin.
Verified Bioactivity
This product does not contain protein kinase domain.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P08069 (Y763-E931)
-
Molecular Construction
-
N-term
-
6*His
-
IGF-I R (Y763-E931)
Accession # P08069 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
IGF1R; IGF-I Receptor; Insulin Like Growth Factor 1 Receptor; MGC18216; Insulin-Like Growth Factor 1 Receptor; Insulin-Like Growth Factor I Receptor; JTK13; Receptor Protein-Tyrosine Kinase; CD221; Tyrosine-Protein Kinase Receptor; IGFIR; CD221 Antigen; I
-
AA Sequence
YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE
-
Molecular Weight
Approximately 21-27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)