Copy Link Print Information

IGFBP-4 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

IGFBP-4 protein modulates IGFs' activity and can either inhibit or stimulate their growth-promoting effects. It alters the interaction between IGFs and their receptors, with a preference for binding to IGF2. This highlights the nuanced role of IGFBP-4 in fine-tuning IGF-mediated cellular responses. IGFBP-4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • IGFBP-4 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IGFBP-4 protein modulates IGFs' activity and can either inhibit or stimulate their growth-promoting effects. It alters the interaction between IGFs and their receptors, with a preference for binding to IGF2. This highlights the nuanced role of IGFBP-4 in fine-tuning IGF-mediated cellular responses. IGFBP-4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-4 protein, expressed by HEK293 , with C-His labeled tag.

Background

IGFBP-4 protein plays a pivotal role in modulating the activity of insulin-like growth factors (IGFs) by extending their half-life. Demonstrating a dual regulatory influence in cell culture, IGFBP-4 can either inhibit or stimulate the growth-promoting effects of IGFs, underscoring its versatile impact on cellular processes. Furthermore, IGFBP-4 is involved in altering the interaction between IGFs and their cell surface receptors. Notably, it exhibits a preference for binding to IGF2 over IGF1, indicating a specific affinity for particular IGF isoforms. This selective binding profile emphasizes the nuanced nature of IGFBP-4's role in fine-tuning the signaling pathways associated with IGF-mediated cellular responses.

Verified Bioactivity

Measured in a serum free cell proliferation assay using MCF7 human breast adenocarcinoma cells (Karey, K.P. et al. 1988, Cancer Research 48: 4083.) . The ED50 for this effect is typically 0.1-0.6 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    P47879 (D22-E254)

  • Gene ID
    16010  [NCBI]
  • Molecular Construction
    • N-term
    • IGFBP-4 (D22-E254)
      Accession # P47879
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IGFBP4; IGF-Binding Protein 4; Insulin Like Growth Factor Binding Protein 4; HT29-IGFBP; IGFBP-4; BP-4; IBP4; IBP-4; Insulin-Like Growth Factor-Binding Protein 4; Insulin-Like Growth Factor Binding Protein 4

  • AA Sequence

    DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGMRCYPPRGVEKPLRTLMHGQGVCTELSEIEAIQESLQTSDKDESEHPNNSFNPCSAHDHRCLQKHMAKIRDRSKMKIVGTPREEPRPVPQGSCQSELHRALERLAASQSRTHEDLFIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFQE

  • Predicted Molecular Mass

    27.2 kDa

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • IGFBP-4 Protein, Mouse (HEK293, His) Product Image
    1/16
  • IGFBP-4 Protein, Mouse (HEK293, His) Product Image