1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFBP-4
  5. IGFBP-4 Protein, Mouse (HEK293, His)

IGFBP-4 protein modulates IGFs' activity and can either inhibit or stimulate their growth-promoting effects. It alters the interaction between IGFs and their receptors, with a preference for binding to IGF2. This highlights the nuanced role of IGFBP-4 in fine-tuning IGF-mediated cellular responses. IGFBP-4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-4 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

IGFBP-4 Protein, Mouse (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IGFBP-4 protein modulates IGFs' activity and can either inhibit or stimulate their growth-promoting effects. It alters the interaction between IGFs and their receptors, with a preference for binding to IGF2. This highlights the nuanced role of IGFBP-4 in fine-tuning IGF-mediated cellular responses. IGFBP-4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-4 protein, expressed by HEK293 , with C-His labeled tag.

Background

IGFBP-4 protein plays a pivotal role in modulating the activity of insulin-like growth factors (IGFs) by extending their half-life. Demonstrating a dual regulatory influence in cell culture, IGFBP-4 can either inhibit or stimulate the growth-promoting effects of IGFs, underscoring its versatile impact on cellular processes. Furthermore, IGFBP-4 is involved in altering the interaction between IGFs and their cell surface receptors. Notably, it exhibits a preference for binding to IGF2 over IGF1, indicating a specific affinity for particular IGF isoforms. This selective binding profile emphasizes the nuanced nature of IGFBP-4's role in fine-tuning the signaling pathways associated with IGF-mediated cellular responses.

Biological Activity

Measured in a serum free cell proliferation assay using MCF7 human breast adenocarcinoma cells (Karey, K.P. et al. 1988, Cancer Research 48: 4083.) . The ED50 for this effect is typically 0.1-0.6 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P47879 (D22-E254)

Gene ID
Molecular Construction
N-term
IGFBP-4 (D22-E254)
Accession # P47879
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
BP-4; HT29-IGFBP; IBP4; Insulin-like growth factor-binding protein 4
AA Sequence

DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGMRCYPPRGVEKPLRTLMHGQGVCTELSEIEAIQESLQTSDKDESEHPNNSFNPCSAHDHRCLQKHMAKIRDRSKMKIVGTPREEPRPVPQGSCQSELHRALERLAASQSRTHEDLFIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFQE

Predicted Molecular Mass
27.2 kDa
분자량

Approximately 38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류

IGFBP-4 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IGFBP-4 Protein, Mouse (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IGFBP-4 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74845
수량:
MCE Japan Authorized Agent: