IGFBP-6 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

IGFBP-6 protein is an important IGFBP member that regulates insulin-like growth factor (IGF) by changing its interaction with cell surface receptors, thereby affecting IGF-induced growth responses. In addition to regulating IGF signaling, IGFBP-6 also activates the MAPK pathway and induces cell migration. IGFBP-6 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-6 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IGFBP-6 protein is an important IGFBP member that regulates insulin-like growth factor (IGF) by changing its interaction with cell surface receptors, thereby affecting IGF-induced growth responses. In addition to regulating IGF signaling, IGFBP-6 also activates the MAPK pathway and induces cell migration. IGFBP-6 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-6 protein, expressed by HEK293 , with C-His labeled tag.

Background

IGFBP-6 Protein, a member of the insulin-like growth factor-binding proteins (IGFBPs), assumes a pivotal role in regulating the half-life of insulin-like growth factors (IGFs) and modulating their effects on cell culture, exhibiting the ability to either inhibit or stimulate IGF-induced growth-promoting responses. This regulatory function is achieved through the alteration of IGFs' interaction with their respective cell surface receptors. Beyond its role in modulating IGF signaling, IGFBP-6 also exhibits additional cellular effects, such as the activation of the MAPK signaling pathway and the induction of cell migration. Notably, IGFBP-6 interacts with PHB2 via its C-terminal domain, highlighting its involvement in protein-protein interactions that may contribute to diverse cellular processes. The multifaceted actions of IGFBP-6 underscore its significance in orchestrating intricate cellular responses associated with growth, migration, and signaling pathways.

Verified Bioactivity

1. Measured by its ability to bind human IGF1 in functional ELISA.
2. Measured by its ability to bind human IGF2 in functional ELISA.
3. Measured by its ability to inhibit the biological activity of IGFII on MCF7 human breast adenocarcinoma cells (Karey, K.P. et al. (1988) Cancer Research 48:4083.). The ED50 for this effect is typically 1-5 μg/mL in the presence of 14 ng/mL human IGFII.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IGFBP-6 (R28-G240)
      Accession # P24592
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IGFBP6; IBP-6; Insulin Like Growth Factor Binding Protein 6; IBP6; Insulin-Like Growth Factor-Binding Protein 6; IGF Binding Protein 6; Insulin-Like Growth Factor Binding Protein 6; IGF-Binding Protein 6; IGFBP-6

  • AA Sequence

    RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

  • Predicted Molecular Mass

    23.9 kDa

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00