IGFBP-7 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

IGFBP-7 Protein, with relatively low IGF-I and IGF-II affinity, stimulates prostacyclin (PGI2) production and enhances cell adhesion. The significance of its interaction with VPS24/CHMP3 remains uncertain and warrants further investigation. IGFBP-7 Protein, Human (HEK293, Fc) is the recombinant human-derived IGFBP-7 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IGFBP-7 Protein, with relatively low IGF-I and IGF-II affinity, stimulates prostacyclin (PGI2) production and enhances cell adhesion. The significance of its interaction with VPS24/CHMP3 remains uncertain and warrants further investigation. IGFBP-7 Protein, Human (HEK293, Fc) is the recombinant human-derived IGFBP-7 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IGFBP-7 protein exhibits a relatively low affinity for binding to both IGF-I and IGF-II. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. It is worth noting that the significance of its interaction with VPS24/CHMP3 remains uncertain and requires further investigation.

Verified Bioactivity

Immobilized Human CD93, His Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Human IGFBP-7, hFc Tag with the EC50 of 0.80 μg/mL determined by ELISA.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IGFBP-7 (S27-L282)
      Accession # Q16270-1
    • hFc
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IGFBP7; IGFBP-RP1; Insulin Like Growth Factor Binding Protein 7; IBP-7; IGFBP-7; TAF; MAC25; Insulin-Like Growth Factor Binding Protein 7; PSF; MAC25 Protein; FSTL2; Angiomodulin; Insulin-Like Growth Factor-Binding Protein 7; IGFBP-7v; Prostacyclin-Stimul

  • AA Sequence

    SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

  • Predicted Molecular Mass

    53.2 kDa

  • Molecular Weight

    Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00