IGFBP-7 Protein, Human (HEK293, His)

IGFBP-7 Protein, with relatively low IGF-I and IGF-II affinity, stimulates prostacyclin (PGI2) production and enhances cell adhesion. The significance of its interaction with VPS24/CHMP3 remains uncertain and warrants further investigation. IGFBP-7 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-7 protein, expressed by HEK293 , with C-6*His labeled tag.

IGFBP-7 protein exhibits a relatively low affinity for binding to both IGF-I and IGF-II. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. It is worth noting that the significance of its interaction with VPS24/CHMP3 remains uncertain and requires further investigation.

Human

HEK293

C-6*His

Q16270-1 (S27-L282)

3490  [NCBI]

Full Length of Isoform-1 Mature Protein

SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.